Recombinant Mouse Prostaglandin F2-alpha receptor (Ptgfr)

Code CSB-CF018979MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ptgfr; Prostaglandin F2-alpha receptor; PGF receptor; PGF2-alpha receptor; Prostanoid FP receptor
Species
Mus musculus (Mouse)
Expression Region
1-366
Target Protein Sequence
MSMNSSKQPVSPAAGLIANTTCQTENRLSVFFSIIFMTVGILSNSLAIAILMKAYQRFRQ KSKASFLLLASGLVITDFFGHLINGGIAVFVYASDKDWIRFDQSNILCSIFGISMVFSGL CPLFLGSAMAIERCIGVTNPIFHSTKITSKHVKMILSGVCMFAVFVAVLPILGHRDYQIQ ASRTWCFYNTEHIEDWEDRFYLLFFSFLGLLALGVSFSCNAVTGVTLLRVKFRSQQHRQG RSHHLEMIIQLLAIMCVSCVCWSPFLVTMANIAINGNNSPVTCETTLFALRMATWNQILD PWVYILLRKAVLRNLYKLASRCCGVNIISLHIWELSSIKNSLKVAAISESPAAEKESQQA SSEAGL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum.
Gene References into Functions
  1. Data, including data from studies using transgenic mice, suggest that signaling via prostaglandin-F2alpha/Ptgfr and Camk2g/p38/Foxo1 MAP kinase/calcium pathways are involved in regulation of hepatic gluconeogenesis in both obesity and fasting. (Ptgfr = prostaglandin F2alpha receptor; Camk2g = calcium-calmodulin-dependent protein kinase type 2 gamma; p38 = p38 MAP kinase; Foxo1 = forkhead box transcription factor O1) PMID: 29773555
  2. Silencing of the FP receptor exerts a protective effect on diabetes-induced vascular remodeling PMID: 26407758
  3. Prostaglandin F-receptor antagonist AS604872 exacerbates vascular inflammation in hypertensive animals, facilitating intracranial aneurysm formation and aortic dissection. PMID: 25341845
  4. Data suggest that expression of Fabp4 (fatty acid binding protein 4) in preadipocytes is up-regulated by arachidonic acid during adipogenesis; this up-regulation appears mediated by prostaglandin F2alpha/FP (prostaglandin F2alpha receptor) signaling. PMID: 25325755
  5. These data suggest that during cuprizone-induced demyelination, PGF2alpha/FP receptor signaling contributes to glial activation, neuroinflammation, and demyelination, resulting in motor dysfunction PMID: 25224839
  6. the role of prostaglandin F2alpha receptor (FP) signaling as a regulator of chondrocyte differentiation, was examined. PMID: 25499765
  7. Low COX-2 activity and the resulting deficiency of PGF2alpha cause increased seizure susceptibility in the immature brain. PMID: 24005111
  8. The F-prostaglandin receptor is a novel marker for tumor endothelial cells in renal cell carcinoma. PMID: 23356224
  9. Relatively selective localization of prostamide/PGF synthase suggests that myelin sheaths of the CNS may serve as the sites for producing prostamide F(alpha) and/or PGF(alpha), which may contribute to the formation and maintenance of central myelin. PMID: 20950588
  10. This study suggested that the PGF(2alpha) FP receptor significantly enhances cerebral ischemic and excitotoxic brain injury. PMID: 19384589
  11. an important role for the FP receptor regulating water and solute transport in these segments of the nephron PMID: 12631554
  12. uteroglobin plays important roles in maintaining homeostasis in organs that are vulnerable to inadvertent stimulation of FP-mediated inflammatory response by inhibiting the prostaglandin F2alpha receptor PMID: 16061484
  13. prostaglandin F synthase and prostaglandin F(2alpha )receptor are involved in the control of testosterone release from Leydig cells PMID: 17674023
  14. The prostaglandin F(2alpha) receptor and progesterone withdrawal are a necessary part of the final common pathway for ripening of the cervix and the process of parturition. PMID: 18003949
  15. These results suggest that oxytocin has potentials to induce strong myometrial contractions in uterus with low expression levels of OTR and luteolysis in ovary, which enabled FP knockout females to undergo successful delivery. PMID: 18083301
  16. pain sensitivity was increased in prostaglandin F receptor mutant mice PMID: 18938093
  17. The alphabeta-methylene ATP-evoked allodynia is mediated by the FP receptor, possibly via the functional coupling between the activation of P2X(2/3) receptors on the central terminal of capsaicin-insensitive fibers and FP receptors on spinal neurons. PMID: 19490931
  18. The rabbit prostaglandin F receptor (FP) couples to the inhibitory G protein, Gi, to inhibit vasopressin action in the cortical collecting duct. PMID: 16096282

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1