Recombinant Mouse Protein-tyrosine sulfotransferase 2(Tpst2)

Code CSB-CF024133MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O88856
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MRLSVRKVLLAAGCALALVLAVQLGQQVLECRAVLGGTRNPRRMRPEQEELVMLGADHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWTKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLARLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGRDKCLPVYYEQLVLHPRRSLKRILDFLGIAWSDTVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPRDVVRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLKGYFQVNQNSTSPHLGSS
Source in vitro E.coli expression system
Gene Names Tpst2
Protein Names Recommended name: Protein-tyrosine sulfotransferase 2 EC= 2.8.2.20 Alternative name(s): Tyrosylprotein sulfotransferase 2 Short name= TPST-2
Expression Region 1-376
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families Protein sulfotransferase family
Tissue Specificity Widely expressed.
Database Links

KEGG: mmu:22022

STRING: 10090.ENSMUSP00000031287

UniGene: Mm.250631

Related Products

Tpst2 Antibodies

Tpst2 Antibodies for Mus musculus (Mouse)

Tpst2 Proteins

Tpst2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.