Recombinant Mouse Protein wntless homolog(Wls)

Code CSB-CF735316MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6DID7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence VPYTAIKCVDVRKNHHKTRWLAPWGPNKCDKIRDIEEAIPREIEANDIVFSVHIPLPSME MSPWFQFMLFILQLDIAFKLNNQIRENAEISMDVSLGYRDDMFSEWTEMAHERVPRKLKC TFTSPKTPEHEGRYYNCDVLPFMEIGSVAHKYYLLNIRLPVNEKKKINVGIGEIKDIRLV GIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINI PVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPI AVGSFCLFIFDMCERGVQLTNPFYSIWTTDVGTELAMAFIIVAGICLCLYFLFLCFMVFQ VFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVSEGHWKW GGVTVQVSSAFFTGIYGMWNLYVFALMFLYAPSHKNYGEDQSNGDLGVHSGEELQLTTTI THVDGPTEIYKLTRKEAQE
Source in vitro E.coli expression system
Gene Names Wls
Protein Names Recommended name: Protein wntless homolog Alternative name(s): Integral membrane protein GPR177 Protein evenness interrupted homolog Short name= EVI
Expression Region 43-541
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulates Wnt proteins sorting and secretion in a feedback regulatory mechanism. This reciprocal interaction plays a key role in the regulation of expression, subcellular location, binding and organelle-specific association of Wnt proteins. Plays also an important role in establishment of the anterior-posterior body axis formation during development.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein, Golgi apparatus membrane, Multi-pass membrane protein, Early endosome membrane, Multi-pass membrane protein
Protein Families Wntless family
Tissue Specificity Expressed in kidney, lung, skin, intestine, brain, spinal cord, skeleton, eyes, excretion glands, tooth and palatal shelves.
Database Links

KEGG: mmu:68151

STRING: 10090.ENSMUSP00000067898

UniGene: Mm.6766

Related Products

Wls Proteins

Wls Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.