Recombinant Mouse Proteinase-activated receptor 4 (F2rl3)

Code CSB-CF007927MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
F2rl3; Par4; Proteinase-activated receptor 4; PAR-4; Coagulation factor II receptor-like 3; Thrombin receptor-like 3
Species
Mus musculus (Mouse)
Expression Region
60-396
Target Protein Sequence
GYPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLALWVLATRVP RLPSTILLMNLAVADLLLALVLPPRLAYHLRGQRWPFGEAACRVATAALYGHMYGSVLLL AAVSLDRYLALVHPLRARALRGQRLTTGLCLVAWLSAATLALPLTLHRQTFRLAGSDRML CHDALPLTEQTSHWRPAFICLAVLGCFVPLLAMGLCYGATLRALAANGQRYSHALRLTAL VLFSAVASFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEF REKVRAMLCRQPEASSSSQASREAGSRGTAICSSTLL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for activated thrombin or trypsin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation.
Gene References into Functions
  1. Par-4 activation and binding to TERT are key steps required for inducing the apoptosis of islet beta cells under high-glucose/fatty acid conditions in type 2 diabetes. PMID: 30186877
  2. these findings are the first to show that internalization of activated PAR4 is linked to proper ERK1/2 and Akt activation. PMID: 27402844
  3. Par4 deficiency offers cardioprotection after acute ischemia reperfusion injury. PMID: 26643815
  4. Bladder PAR4 stimulation affected urothelial HMGB1 release. PMID: 27010488
  5. Thrombin cleavage of platelet PAR4 promotes leukocyte recruitment to sites of vascular injury. PMID: 26204458
  6. PAR4 blockade impairs neutrophil migration in vivo, suggesting that PAR4 plays an important role in the regulation of inflammation PMID: 25118784
  7. PAR-4 appears to play a hitherto unsuspected role in diabetic vasculopathy. PMID: 25239438
  8. mPAR4 contributes to antibacterial defence during murine pneumococcal pneumonia PMID: 23783078
  9. PAR-4 as a potential target for future therapeutic strategies against platelet-mediated liver injury on transplantation. PMID: 24434483
  10. Results demonstrate that PAR-4 does not play a significant role during pulmonary fibrosis. PMID: 23024330
  11. These data suggest a key role for PAR4 in mediating neutrophil recruitment in a mouse model of pleurisy induced by the activity of trypsin or trypsin-like enzymes PMID: 22517275
  12. Data suggest that PAR-4 activation is endogenously involved as a feedback loop to attenuate inflammatory colonic hyperalgesia to colorectal distension. PMID: 22044612
  13. PARs are involved in the modulation of joint pain, with PAR-4 being pronociceptive in this tissue. Thus, blockade of articular PAR-4 may be a useful means of controlling joint inflammation and pain [PAR-4]. PMID: 19248120
  14. arrestin-2 regulates PAR4-dependent signaling pathways, but not responses to ADP alone, and contributes to thrombus formation in vivo. PMID: 21106537
  15. this work demonstrates a key role for PAR-4 in mediating eosinophil recruitment in an allergic pleurisy model in mice PMID: 20829647
  16. Data indicate that deficiency of PAR4 protects mice from cerebral ischemia/reperfusion (I/R) injury, partially through inhibition of platelet activation and attenuation of microvascular inflammation. PMID: 20087365
  17. The current study proves for the first time that PAR4 is localised in mossy fibre axons. The altered expression in CA3 neurons after ischaemia indicates that PAR4 may be involved in post-ischaemic adaptive mechanisms. PMID: 19859967
  18. PAR4 activation mediates the potentially detrimental effects of thrombin on microglia, implying that perspectives of exploiting PAR1 as a potential anti-inflammatory target should be shifted toward PAR4 PMID: 12775717
  19. mice that lacked both PAR4 and fibrinogen exsanguinated at birth like prothrombin-deficient mice PMID: 14504091
  20. platelets treated with a PAR-4 antagonist, as well as platelets isolated from PAR-4 homozygous null mice, failed to aggregate in response to plasmin; plasmin induces platelet aggregation primarily through slow cleavage of PAR-4. PMID: 14973136
  21. PAR4 heterozygosity conferred some protection against metastasis in a melanoma metastasis model PMID: 15031212
  22. PAR4 has a role in thrombin signaling in platelets PMID: 15304051
  23. Par4 has an important role in tumour suppression, with a particular relevance in the endometrium and prostate. PMID: 15877079
  24. Thrombin activation of PAR4 may occur with exosite I available to bind cofactor molecules, like the cleaved form of PAR3. PMID: 17606903
  25. An important role for PAR-4 in the Shwartzman reaction; inhibition of PAR-4 signaling in neutrophils could be protective in systemic inflammation and disseminated intravascular coagulation. PMID: 17641206
  26. The activation of PAR-4 on platelets is crucial in soluble tissue factor-induced inflammation PMID: 18412955
  27. Par4 deficiency of the mother, or the absence of maternal platelets, restores normal development in one-third of Thbd-null embryos PMID: 18490515
  28. PAR4 signaling enhances platelet aggregate stability by mechanisms independent of other thrombin-dependent pathways such as fibrin formation. PMID: 18983510
  29. results identify PAR(4) as a previously unknown modulator of visceral nociception PMID: 19413681
  30. murine platelets are more sensitive to plasmin than human platelets due to differences in the primary sequence of PAR4. In contrast to thrombin-dependent activation of platelets,, mPAR3 inhibits plasmin-induced PAR4 activation. PMID: 19437337
  31. findings demonstrated that activation of PAR(4) on colonic dorsal root ganglia neurons suppresses their excitability PMID: 19566587
  32. Mechanism of the anticoagulant activity of thrombin mutant W215A/E217A. PMID: 19586901

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in the spleen. Slight expression in the heart, lung, skeletal muscle and kidney. No detectable expression in brain, liver or testis. Also detected in platelets.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1