Recombinant Mouse Reactive oxygen species modulator 1 (Romo1)

In Stock
Code CSB-CF020063MO
Abbreviation Recombinant Mouse Romo1 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Romo1
Uniprot No.
Research Area
Others
Alternative Names
Romo1; Reactive oxygen species modulator 1; ROS modulator 1; Protein MGR2 homolog
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-79aa
Target Protein Sequence
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1) is produced through an in vitro E.coli expression system and covers the full-length protein sequence from amino acids 1 to 79. The protein includes an N-terminal 10xHis-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows that Romo1 purity exceeds 85%, suggesting reliable performance for research work. This product is strictly for research use and should not be used for diagnostic or therapeutic purposes.

Reactive oxygen species modulator 1 (Romo1) appears to play an important role in how cells handle oxidative stress by managing reactive oxygen species (ROS) levels. The protein seems integral to various cellular pathways, particularly those involving mitochondrial function and oxidative stress responses. Research into Romo1 may be essential for understanding how it contributes to cellular balance and what this might mean for oxidative stress-related studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

While the in vitro E. coli expression system can produce soluble protein and allows some control over folding conditions, it completely lacks the mitochondrial membrane environment and specific chaperones essential for Romo1's correct integration and native folding. The protein is highly unlikely to achieve its functional, membrane-embedded conformation. Its biological activity in ROS regulation is suspect without validation in a proper membrane context. This application is not recommended. A misfolded, soluble version of a membrane protein is prone to massive non-specific (false-positive) hydrophobic interactions. It will not be integrated into a membrane and thus cannot interact with partners in its physiological context, leading to false negatives. Any interaction data would be uninterpretable and misleading.

1. Antibody Development and Validation

This recombinant Romo1 serves as a suitable immunogen for generating antibodies against the linear sequence of the protein. The full-length design ensures coverage of all potential linear epitopes. Antibodies produced against this non-membrane-associated antigen will likely be most effective for detecting denatured Romo1 (e.g., in Western blots). However, it may be limited to use these antibodies to study the native Romo1 protein.

2. Biochemical Characterization and Stability Studies

This is the essential first step to characterize the biophysical properties of this specific protein preparation. Techniques like SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) and CD (Circular Dichroism) can determine its oligomeric state, stability, and secondary structure in solution. This data is critical for understanding the protein's quality but describes the properties of a misfolded soluble variant, not the native membrane protein.

3. ELISA Development and Quantification Assays

This Romo1 protein is well-suited as a quantitative standard in an ELISA designed to measure the total concentration of Romo1 in a sample (e.g., a denatured lysate). The assay relies on antibody binding to linear epitopes, so the protein's non-native conformation is not a limitation for this specific application.

Final Recommendation & Action Plan

The expression system is fundamentally mismatched with the native biology of this membrane protein, severely limiting its functional applications. The immediate and mandatory first step is Application 2 (Biochemical Characterization) to understand the physical properties of the produced protein. It can be reliably used for Application 3 (as an ELISA standard) and Application 1 (Antibody Development against linear epitopes). For any functional investigation of Romo1 (interactions, activity), the only scientifically valid path is to study the protein in its correct cellular context, either by immunoprecipitating the endogenous protein from mammalian cells or by using a eukaryotic expression system that can target Romo1 to the mitochondrial membrane.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage.; Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation.
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Protein Families
MGR2 family
Tissue Specificity
Detected in brain, liver and kidney.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*