Recombinant Mouse Relaxin-3 receptor 2(Rxfp4)

Code CSB-CF759735MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7TQP4
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MATSNSSASLPTLFWVNGSGDSVLSTDGAAMPVQFLVLRIMVALAYGLVGIIGLLGNLAV LWVLGNCGQRVPGLSSDTFVFSLALADLGLALTLPFWATESAMDFHWPFGSALCKVVLTT TVLSIYASTFLITALSIARYWVVAMAVGPGSHLSVFWARVVTLAVWVAAALVTVPTAIFG AEVELWGVCLCLLRFPSRYWLGAYQLQRVVLAFIVPLGVITTSYLLLLAFLERQQRCRPR QWQDSRVVARSVRVLVASFALCWVPNHVVTLWEILVRFDLVPWDSTFYTFHTYILPITTC LAHSNSCLNPVIYCLLRREPQQVLVSSFRALWSRLWPQRKACMEQMALKEVGGRTVASTQ ESGSSRTHTNTMEHLDEGCSLNTLLSETYQGQSPQILGRSSCSLSQAAVSPGEV
Source in vitro E.coli expression system
Gene Names Rxfp4
Protein Names Recommended name: Relaxin-3 receptor 2 Short name= RLN3 receptor 2 Alternative name(s): G-protein coupled receptor 100 Insulin-like peptide INSL5 receptor Relaxin family peptide receptor 4
Expression Region 1-414
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function High affinity receptor for INSL5. Also acts as receptor for RLN3/relaxin-3, as well as bradykinin and kallidin. Binding of the ligand inhibit cAMP accumulation (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Detected only in bone marrow.
Database Links

KEGG: mmu:242093

STRING: 10090.ENSMUSP00000058732

UniGene: Mm.269130

Related Products

Rxfp4 Proteins

Rxfp4 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.