Recombinant Mouse Sideroflexin-1(Sfxn1)

Code CSB-CF857476MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Sfxn1
Uniprot No. Q99JR1
Alternative Names Sfxn1; Sideroflexin-1
Species Mus musculus (Mouse)
Expression Region 2-322
Target Protein Sequence SGEVPPNINIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPA GLTENELWRAKYAYDSAFHPDTGEKMTLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQ WINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKRVSPLIGRFVP FAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGM AIPPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDE LQASIQRTHPEIRRVYFNKGL
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway. Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors. Transports both D-serine and L-serine. Also able to transport other amino-acids, such as alanine. May be indirectly involved in the transport of a component required for iron utilization into or out of the mitochondria.
Gene References into Functions
  1. Connexin32 interacts with connexin26 and the mitochondrial protein, sideroflexin-1, at the plasma membrane forming a novel signaling nexus. PMID: 23590695
Involvement in disease Defects in Sfxn1 are the cause of a transitory hypochromic, microcytic anemia characterized by a large number of siderocytes containing non-heme iron granules. The anemia begins at 12 dpc, is most intense at 15 dpc and is still severe at birth, but disappears by 2 weeks of age. Mutant adults are no longer anemic, but they have an impaired response to hemopoietic stress. Most homozygotes also have flexed tails and a belly spot.
Subcellular Location Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families Sideroflexin family
Tissue Specificity Widely expressed, with highest expression in kidney and liver.
Database Links

KEGG: mmu:14057

STRING: 10090.ENSMUSP00000021930

UniGene: Mm.134191

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1