Recombinant Mouse Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (Sdhd)

Code CSB-CF887466MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Sdhd; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; CII-4; QPs3; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Species
Mus musculus (Mouse)
Expression Region
57-159
Target Protein Sequence
SGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGLGQVVTDYVH GDTLPKAARAGLLALSALTFAGLCYFNYHDVGICRAVAMLWKL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Gene References into Functions
  1. Sdhd knockout from the thyroid is sufficient to cause excess thyroid cell growth in mice, which may play a role in tumor initiation PMID: 28928232
  2. the actual dependency of undifferentiated hematopoietic stem cells on mitochondrial function, we have performed an analysis of the hematopoiesis in a mouse mutant, named SDHD-ESR, with inducible deletion of the mitochondrial protein-encoding SdhD gene, is reported. PMID: 27929539
  3. Loss of SDH activity leads to changes in the metabolism of non-essential amino acids. PMID: 26522426
  4. In mice with conditional knockout of Sdhd, we found that the Cdkn1a gene was up-regulated in kidney and adrenal. This gene encodes the cyclin-dependent kinase inhibitor p21(WAF1/Cip1), a factor implicated in cell cycle, senescence, and cancer. PMID: 24465590
  5. complete loss of SdhD is not sufficient to induce tumorigenesis in mice PMID: 22711987
  6. SDHD is required for the formation of a stable mitochondrial complex II, and it is selectively important for hypoxic pulmonary vasoconstriction of intra-acinar vessels. PMID: 22215723
  7. Knockout of Sdhd in the mouse does not result in a disease phenotype; H19 may not be an initiator of PGL/PC tumorigenesis PMID: 19956719
  8. Mitochondrial Sdhd is required for early embryogenesis, and its partial deficiency results in persistent carotid body glomus cell activation with full responsiveness to cell hypoxia. PMID: 15572694

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
CybS family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1