Recombinant Mouse Synaptotagmin-1 (Syt1)

Code CSB-CF023029MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Syt1; Synaptotagmin-1; Synaptotagmin I; SytI; p65
Species
Mus musculus (Mouse)
Expression Region
1-421
Target Protein Sequence
MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium sensor that participates in triggering neurotransmitter release at the synapse. May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2. Plays a role in dendrite formation by melanocytes.
Gene References into Functions
  1. Mutating Ca(2+)-coordinating aspartates in the C2A-domain localizes Doc2B permanently at the plasma membrane, and renders an upstream priming step Ca(2+)-independent, whereas a separate function in downstream priming depends on SNARE-binding, Ca(2+)-binding to the C2B-domain of Doc2B, interaction with ubMunc13-2 and the presence of synaptotagmin-1. PMID: 29274147
  2. Study showed postsynaptic localization of synaptotagmin 1, at concentrations moderately lower than, but comparable to presynaptic concentrations. It is present in significant concentrations at the postsynaptic density, pointing to the likelihood of insertion of glutamate receptors directly into the synaptic plasma membrane. Synaptotagmin 1 is reduced in postsynaptic spines after eight weeks of kainite-induced epilepsy. PMID: 28686803
  3. that reduction in the synaptotagmin 1 level and presenilin 1-synaptotagmin 1 interactions in AD brain may present molecular underpinning of the pathogenic presenilin 1 conformation PMID: 28193235
  4. Authors propose that the strong reduction of Syt2 and SV2B are key factors of the functional synaptic alteration and that the physiological downregulation of Syt1 plays a determinant role in muscle vulnerability in SMA. PMID: 28173138
  5. we identify Syt2 as a functionally important Ca(2+) sensor at fast-releasing inhibitory synapses, and show that Syt1 and Syt2 can redundantly control transmitter release at specific brain synapses PMID: 28363983
  6. results suggest that postsynaptic Syt1 and Syt7 act as redundant Ca(2+)-sensors for Ca(2+)-dependent exocytosis of AMPA receptors during long-term potentiation, and thereby delineate a simple mechanism for the recruitment of AMPA receptors that mediates LTP PMID: 28355182
  7. demonstrates a developmental Syt1-Syt2 isoform switch at an identified synapse, a mechanism that could fine-tune the speed, reliability, and plasticity of transmitter release at fast releasing CNS synapses. PMID: 27210552
  8. the combined inactivation of all 3 E-Syt genes has no effect on mouse viability or fertility. PMID: 27399837
  9. We conclude that synaptotagmin-1 phosphorylation is an essential step in PKC-dependent potentiation of synaptic transmission, acting downstream of the two other essential DAG/PKC substrates, Munc13-1 and Munc18-1. PMID: 27091977
  10. data show that hepatic Syt1 expression is influenced by diet and hormonal milieu PMID: 26709651
  11. different structural states of syt underlie the control of distinct forms of synaptic transmission. PMID: 27001899
  12. The interaction of Dvl1 with Syt-1, which is regulated by Wnts, modulates neurotransmitter release. PMID: 26400647
  13. Data (including data from studies in knockout mice) suggest that loss of both Syt1/Syt7 decreases capacity of readily-releasable pool (RRP) of Ca2+ in synaptic vesicles without altering rate of priming into RRP; Syt1/Syt7 functions appear redundant. PMID: 26437117
  14. Syt-1 regulates Abeta levels in mouse neurons. Knockdown of endogenous Syt-1 in mouse primary neurons led to a significant reduction in both Abeta40 and Abeta42 generation. PMID: 26202512
  15. Increased expression of Syt1 in neural stem cells is essential for neurogenesis progression. PMID: 24973144
  16. This study provides new insights in how the two opposite sides of the C2B domain of Synaptotagmin-1 participate in secretory vesicle fusion, and in more upstream steps, especially vesicle docking. PMID: 26490858
  17. atomic-resolution crystal structures of Ca(2+)- and Mg(2+)-bound complexes between synaptotagmin-1 and the neuronal SNARE complex PMID: 26280336
  18. the Ca(2+) dependence of the interaction between PRIP-C2 and Syt1-C2A was attributed to Ca(2+) binding with Syt1-C2A, but not PRIP-C2, using a series of mutants prepared from both C2 domains. PMID: 25242442
  19. Tissue-specific splicing, posttranslational modification and the variation in expression might suggest a different requirement of SYT1 for the specific function in each organ. PMID: 25735570
  20. This study reveals fundamental details of how phosphorylation of Thr84 on SV2A controls its interaction with synaptotagmin-1 and implicates SV2A as a phospho-dependent chaperone PMID: 25673844
  21. The syt function is markedly affected by changes in the physical nature of the linker that connects its tandem C2 domains. Moreover, the linker mutations uncoupled syt-mediated regulation of evoked and spontaneous release. PMID: 24657966
  22. In mixed glutamatergic/GABAergic neurons, excitatory postsynaptic potential (EPSP) frequencies were increased in synaptotagmin-1-null neurons. PMID: 24501351
  23. Ca(2+)-triggered release at a synapse is due to synaptotagmins, with synaptotagmin-7 mediating a slower form of Ca(2+)-triggered release that is normally occluded by faster synaptotagmin-1-induced release but becomes manifest upon synaptotagmin-1 deletion PMID: 24267651
  24. Syt-1 SNARE-interacting domains are essential for vesicle docking, priming, and fast fusion-triggering in chromaffin cells. PMID: 24005294
  25. Synaptotagmins 1 and 2 as mediators of rapid exocytosis at nerve terminals: the dyad hypothesis PMID: 23648184
  26. APP interacts with the calcium sensor synaptotagmin-1 of synaptic vesicles and might thus play a role in the regulation of synaptic vesicle exocytosis. PMID: 22731840
  27. Data suggest that Syt1 may act as a MTOC-associated protein to play important roles in mouse oocyte spindle organization/stability, and that it is indispensable for the metaphase-anaphase transition to promote mouse oocyte meiotic maturation. PMID: 22313732
  28. The dynamics of vesicle fission during clathrin-mediated endocytosis is Ca(2)+ dependent but becomes Ca(2)+ independent in synaptotagmin 1 knock-out cells. PMID: 22423098
  29. This study demonistrated that syt1 functions as a dual Ca(2+) sensor for both endo- and exocytosis, potentially coupling these two components of the vesicle cycle. PMID: 22197832
  30. This system recapitulates some of the effects of syt mutations that alter synaptic transmission in neurons. It demonstrate that the cytoplasmic domain of syt exhibited mixed agonist/antagonist activity during regulated membrane fusion in cells. PMID: 22184197
  31. this study demonistrated that Alcohol induces synaptotagmin 1 expression in neurons via activation of heat shock factor 1 PMID: 21816209
  32. A test of Syt1 exocytosis in otoferlin-deficient hippocampal neurons and Syt1-deficient inner hair cells finds no deficits in vesicle fusion. PMID: 21451027
  33. new-synthesized synaptotagmin1 following synaptic plasticity may contribute to long-lasting synaptic plasticity via positive, feedfoward mechanisms PMID: 21129439
  34. The Syt7 C2B domain structure is very similar to that of the Syt1 C2B domain and contains three Ca2+-binding sites. PMID: 20824061
  35. Transient expression of Syt1 is no longer detected in cochlear inner hair cells (IHCs) after the onset of hearing, indicating that the most common calcium-ion sensors in the central nervous system are not involved in the mature IHC ribbon synapse. PMID: 20926654
  36. Expression of Syt1 in the mouse prefrontal cortex is modulated by a sequence variant (B2 SINE indel) in the 3' UTR of Comt (catechol-O-methyltransferase). PMID: 20808911
  37. 1.9-A X-ray structure of the BoNT serotype G receptor binding domain on the protein receptor synaptotagmin (Syt) I/II. PMID: 20219474
  38. intestinal epithelial Syt 1 plays an important role in cAMP-stimulated endocytosis of apical NHE3 through cAMP-dependent phosphorylation of S605 that is required for NHE3 and Syt 1 association PMID: 19926819
  39. synaptotagmin-I expressing neuroblastoma cells require gangliosides for Botulinum neurotoxin A activity PMID: 12089155
  40. In synaptotagmin 1 knockout mice, the fast component of both Ca(2+)- and Sr(2+)-induced neurotransmitter release is impaired, suggesting that both cations partly act by binding to synaptotagmin 1. PMID: 12526776
  41. Ca2+-dependent phospholipid binding to synaptotagmin 1 mirrors the intracellular Ca2+ dependence of exocytosis. PMID: 12939392
  42. syts I and II can function as protein receptors for Botulinum neurotoxin b and mediate its entry PMID: 14504267
  43. alternative translation of synaptotagmin 1 mediates the non-classical release of fibroblast growth factor 1 PMID: 14559220
  44. Synaptotagmins I and II are nerve cell receptors for botulinum neurotoxin G PMID: 15123599
  45. Synaptotagmin I synchronizes the rapid release of neurotransmitters after Ca2+ entry into presynaptic terminals and also appears to suppress the slower, asynchronous form of transmitter release. PMID: 15240804
  46. We have used point mutagenesis to determine the functional contributions to triggering synchronous neurotransmitter release of the five negatively charged aspartate residues that constitute the Ca2+-binding sites in the C2B domain of synaptotagmin I. PMID: 15456828
  47. SV2B-synaptotagmin 1 complex is involved in the regulation of synaptotagmin 1 stability and/or trafficking PMID: 15466855
  48. endocytosis is significantly impaired in the absence of SytI with the relative rates of endocytosis compared with exocytosis reduced approximately 3-fold with respect to wild type PMID: 15492212
  49. synaptotagmin 1 function requires a free C terminus, possibly because of spatial constraints at the release sites PMID: 15561725
  50. We conclude that synaptotagmin self-oligomerization is unlikely to play any significant role in triggering synaptic vesicle exocytosis. PMID: 15886015

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm.
Protein Families
Synaptotagmin family
Tissue Specificity
Expressed in the brain and adrenal medulla (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1