Recombinant Mouse Thromboxane A2 receptor (Tbxa2r)

Code CSB-CF023260MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Tbxa2r; Thromboxane A2 receptor; TXA2-R; Prostanoid TP receptor
Species
Mus musculus (Mouse)
Expression Region
1-341
Target Protein Sequence
MWPNGTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS SFLALLCGLVLTDFLGLLVTGAIVASQHAALLDWRATDPSCRLCYFMGVAMVFFGLCPLL LGAAMASERFVGITRPFSRPTATSRRAWATVGLVWVAAGALGLLPLLGLGRYSVQYPGSW CFLTLGTQRGDVVFGLIFALLGSASVGLSLLLNTVSVATLCRVYHTREATQRPRDCEVEM MVQLVGIMVVATVCWMPLLVFIMQTLLQTPPVMSFSGQLLRATEHQLLIYLRVATWNQIL DPWVYILFRRSVLRRLHPRFSSQLQAVSLRRPPAQAMLSGP
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C and adenylyl cyclase.
Gene References into Functions
  1. The results suggest that EP3 along with TP contributes to vasoconstrictor responses evoked by PGI2, and hence imply a novel mechanism for endothelial cyclooxygenase metabolites (which consist mainly of PGI2) in regulating vascular functions. PMID: 28165064
  2. platelet GP6 and thromboxane A2 receptor have a role in promoting inflammatory macrophage phenotype in skin inflammation PMID: 27818280
  3. Genetic deletion of thromboxane receptor in adipose-derived stromal cells accelerated endothelial cell differentiation. PMID: 26957525
  4. PKCalpha deficiency leads to pulmonary vascular hyperresponsiveness to TXA2, possibly via increased pulmonary arterial TP receptor expression. PMID: 26890419
  5. Uridine adenosine tetraphosphate induced aortic contraction depends on activation of TX synthase and thromboxane A2 receptor, which partially requires the activation of P2X1R through an endothelium-dependent mechanism. PMID: 25921923
  6. It is an active player in the pathogenesis of Alzheimer's disease. PMID: 25457549
  7. Adhesion of platelets through thromboxane A receptor signaling facilitates liver repair during acute chemical-induced hepatotoxicity. PMID: 25921763
  8. The results indicate that the beta1-subunit can form a tripartite complex with TP and MaxiKalpha, has the ability to associate with each protein independently. PMID: 23255603
  9. Blocking the expression of the thromboxane receptor significantly suppresses the prothrombotic effect of C-reactive protein. PMID: 22879580
  10. The thromboxane A(2) receptor agonist 11-deoxy PGF(2alpha) can partially alleviate embryo crowding in the Lpar3((-/-)) females and embryo crowding likely contributes to reduced litter size in the Lpar3((-/-)) females. PMID: 22222195
  11. We show here that thromboxane receptor in the striatum locally facilitates dopamine overflow. PMID: 21749493
  12. thromboxane A2 receptor signalling does not contribute critically to the pathogenesis of ischemic acute kidney injury PMID: 21449636
  13. Thromboxane A2 receptor activation via PKC-zeta-mediated NAD(P)H oxidase activation increases superoxide and peroxynitrite, resulting in eNOS uncoupling in endothelial cells. PMID: 20947827
  14. Genetic variations exist in this protein in platelet function disorders. PMID: 20162250
  15. thromboxane synthase, prostacyclin synthase and thromboxane receptor have roles in atherosclerotic lesions and correlate with plaque composition PMID: 19735918
  16. TXA2-TP signaling modulates acquired immunity by negatively regulating DC-T cell interactions. PMID: 12778172
  17. Thromboxane A2 (TXA2)-mediated platelet secretion and aggregation are important in thrombosis and the stable TXA2 analogue, U46619, induces two waves of platelet secretion, each of which precedes a distinct wave of platelet aggregation PMID: 12796499
  18. Activation of TP receptors promotes T cell proliferation, and contributes to immune-mediated tissue injury. PMID: 14662837
  19. Thromboxane A2 receptor has a role in the pathogenesis of angiotensin II-dependent hypertension. PMID: 14718360
  20. TP -/- mice have a basal increase in renal vascular resistance and filtration fraction associated with reactive oxygen species. PMID: 15213069
  21. TXA2 promotes and PGI2 prevents the initiation and progression of atherogenesis through control of platelet activation and leukocyte-endothelial cell interaction in Apolipoprotein e deficient mice. PMID: 15372102
  22. Baseline systolic blood pressure did not differ between TP(-/-) and TP(+/+) mice. PMID: 15635218
  23. Endothelial cells genetically lacking thromboxand receptor show reduced inflammatory responses when stimulated with isoprostane F2alpha-III but not other oxidized lipids. PMID: 16267259
  24. Endogenous activation of TXA2 receptor by eicosanoids did not modulate spontaneous neovascularization in the setting of ischemia. PMID: 16385086
  25. Increased responsiveness of thromboxane A(2) receptors occurs in diabetic ApoE-KO mouse kidneys. PMID: 17942572
  26. blockage of thromboxane receptors provoked embolus formation in wildtype blood PMID: 18000613
  27. 12/15LO- and TxA(2) receptor-mediated pro-atherogenic effects are two distinct pathways PMID: 18206890
  28. COX-1 contributes to the enhanced formation of both PGI(2) and TXA(2) in atherosclerosis, and to the development of the disease PMID: 18514659
  29. in L-NAME hypertension, TP receptors contribute to elevated blood pressure and cardiac hypertrophy; In this model, TP receptors also provided unexpected protection against kidney injury. PMID: 18684890
  30. Demonstrate that isoprostanes inhibit angiogenesis via activation of the TBXA2R. PMID: 18802021
  31. thromboxane receptor knockout mice showed normal pain behavior in all tests PMID: 18938093
  32. the results from the present and previous studies suggest an autocrine loop, involving cyclooxygenase-2, thromboxane A synthase, and thromboxane A2 and its receptor, in cyclooxygenase-2-dependent inhibition of StAR gene expression. PMID: 19325001
  33. Thromboxane A2 receptor stimulation impairs insulin signaling in vascular endothelial cells by selectively activating the Rho/Rho-associated kinase/LKB1/PTEN pathway. PMID: 19403525

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1