Recombinant Mouse Thyrotropin-releasing hormone receptor (Trhr)

Code CSB-CF024441MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Trhr
Uniprot No.
Alternative Names
Trhr; Thyrotropin-releasing hormone receptor; TRH-R; Thyroliberin receptor
Species
Mus musculus (Mouse)
Expression Region
1-393
Target Protein Sequence
MENDTVSEMNQTELQPQAAVALEYQVVTILLVVIICGLGIVGNIMVVLVVMRTKHMRTPT NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVVSCG YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIH QNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKAANYSVALNYSVIKES DRFSTELEDITVTDTYVSTTKVSFDDTCLASEN
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for thyrotropin-releasing hormone (TRH). Upon ligand binding, this G-protein-coupled receptor triggers activation of the phosphatidylinositol (IP3)-calcium-protein kinase C (PKC) pathway.
Gene References into Functions
  1. activating TRH/TRH-R1 signaling seems not to be sufficient for gastric stimulation of acylated ghrelin production PMID: 25490146
  2. The central nervous systems effects of taltirelin are mediated primarily by TRH-R1 and not TRH-R2. PMID: 23303050
  3. We suggest that persistent signaling by TRHRs is exhibited when sufficient levels of agonist/receptor/G-protein complexes are established and maintained and that TRH-R2 forms and maintains these complexes more efficiently than TRH-R1. PMID: 22593547
  4. three distinct and discontinuous regions of the TSHR (aa 246-260 and 277-296 on the TSHR A subunit) and aa 381-385 (on the TSHR B subunit) fold together to form a complex TSH binding pocket. PMID: 12593718
  5. the TSHR may not be similar to other model proteins used to define the concept of central immune tolerance. PMID: 14630711
  6. TRH-R1 has a role in mouse lactation and mice lacking the receptor show signs of central hypothyroidism PMID: 14988432
  7. Thyrotropin-releasing hormone binding induces separation of cytoplasmic ends of TRH receptor type 1 transmembrane helix 5 (TMH5) and TMH6 and a rotation of TMH6 that could promote interactions between G proteins and key residues within the TRH receptor. PMID: 15709754
  8. Beta-arrestin has a role in desensitization and internalization but not phosphorylation of the thyrotropin-releasing hormone receptor, which causes translocation of endogenous GRK2 to the plasma membrane PMID: 16183993
  9. the endogenous TRH system is involved in mood regulation, and this function is carried out through TRH-R1-mediated neural pathways PMID: 17666589
  10. A flexible molecular docking procedure revealed that TRH establishes a direct interaction with W6.48 in TRH-R2 but not in TRH-R1. PMID: 17979196
  11. Direct TRH receptor-mediated excitation of histaminergic tuberomamillary neurons by thyrotropin-releasing hormone demands activation of nonselective cation channels as well as electrogenic sodium/divalent calcium ion exchange. PMID: 19357273

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X