Recombinant Mouse Uracil nucleotide/cysteinyl leukotriene receptor (Gpr17)

Code CSB-CF764656MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Gpr17; Uracil nucleotide/cysteinyl leukotriene receptor; UDP/CysLT receptor; G-protein coupled receptor 17
Species
Mus musculus (Mouse)
Expression Region
1-339
Target Protein Sequence
MNGLEAALPSLTDNSSLAYSEQCGQETPLENMLFACFYLLDFILAFVGNALALWLFIWDH KSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIPCRLTGFLFYLNMYASIY FLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWIVVAVAMAPLLVSPQTVQTNHTVV CLQLYREKASHHALASLAVAFTFPFITTVTCYLLIIRSLRQGPRIEKHLKNKAVRMIAMV LAIFLICFVPYHIHRSVYVLHYRGGGTSCAAQRALALGNRITSCLTSLNGALDPVMYFFV AEKFRHALCNLLCSKRLTGPPPSFEGKTNESSLSARSEL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dual specificity receptor for uracil nucleotides and cysteinyl leukotrienes (CysLTs). Signals through G(i) and inhibition of adenylyl cyclase. May mediate brain damage by nucleotides and CysLTs following ischemia.
Gene References into Functions
  1. Study defined the differentiation capabilities of GPR17+ cells in rodents after myelin disruption in two different models, the former characterized by diffused immune response against myelin components and strong inflammation (the EAE model), and the latter one consisting in local demyelination induced by a toxic agent (the cuprizone model). PMID: 29424466
  2. Transcription factor FoxO1 regulates glucose metabolism and feeding through the expression of Gpr17 in hypothalamic AgRP neurons. PMID: 22682251
  3. Conditional knockout of Gpr17 in hypothalamic AgRP neurons improves glucose metabolism and energy homeostasis by increasing central sensitivity to insulin and leptin. PMID: 26180086
  4. G protein-coupled receptor, Gpr17, was identified as the target of transcription factor FoxO1 to mediate its function in feeding regulation in hypothalamic AgRP neurons, suggesting it is a new drug target for metabolic disorders via actions on appetite control. PMID: 22682251
  5. The role of oligodendrocyte precursor cells expressing the GPR17 receptor in brain remodeling after stroke. PMID: 28594400
  6. The loss of Gpr17 in mice led to precocious myelination and an earlier onset of remyelination after demyelination PMID: 27733608
  7. uracil nucleotides and cysteinyl leukotrienes do not activate human, mouse, or rat GPR17 in various cellular backgrounds. PMID: 28254957
  8. GPR17(+) cells--in contrast to GPR17(-) NG2-glia--did not differentiate within 3 months, a peculiarity that was overcome after cerebral damage induced by acute injury or ischemia PMID: 26464068
  9. stimulation of GPR17 by the small molecule agonist MDL29,951 (2-carboxy-4,6-dichloro-1H-indole-3-propionic acid) decreases myelin basic protein expression levels mainly by triggering the Galphai/o signaling pathway. PMID: 26620557
  10. Agrp-Gpr17(-/-) mice show reduced food intake, increased relative energy expenditure, and increased satiety, resulting in leanness and reduced body fat. They also show increased central nervous system sensitivity to insulin and leptin. PMID: 26180086
  11. The mouse GPR17 receptor plays a central role in the early response of cardiac stromal cells to ischaemia. PMID: 24909956
  12. Data indicate that small molecule MDL29,951 activates human, mouse and rat orphan G protein-coupled receptor GPR17. PMID: 24150254
  13. GPR17 is a marker for progenitor progression within the oligodendroglial lineage that participates in postacute reactivity of NG2-proteoglycan expressing cells in different injury paradigms. PMID: 21956849
  14. analysis of agonist-induced trafficking of native GPR17 in oligodendroglial cells PMID: 23288840
  15. Study finds that transcription factor FoxO1 exerts integrative control of leptin, insulin, and amino acid signaling in AgRP neurons, effectively coordinating food intake with peripheral metabolism; and identifies of a heretofore unrecognized FoxO1 pathway that regulates food intake through the G protein-coupled receptor, Gpr17. PMID: 22682251
  16. GPR17 is expressed by a subpopulation of oligodendrocyte precursor cells, but not by astrocytes; this expression pattern is also confirmed in vivo. In vitro, GPR17 expression is markedly influenced by culturing conditions. PMID: 21264945
  17. GPR17 negatively regulates type 1 cysteinyl leukotriene receptor (CysLT1R)-mediated inflammatory cell accumulation in the bronchoalveolar lavage fluid and lung, in both the antigen presentation and downstream phases of allergic pulmonary inflammation. PMID: 20574000
  18. GPR17 orchestrates the transition between immature and myelinating oligodendrocytes via an ID protein-mediated negative regulation and may serve as a potential therapeutic target for CNS myelin repair. PMID: 19838178
  19. GPR17 may act as a "sensor" that is activated upon brain injury on several embryonically distinct cell types, and may play a key role in both inducing neuronal death inside the ischemic core and in orchestrating the local remodeling/repair response. PMID: 18974869
  20. GPR17 is a negative regulator of the cysteinyl leukotriene 1 receptor response to leukotriene D4. PMID: 19561298

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1