Recombinant Mouse Urea transporter 1 (Slc14a1)

Code CSB-CF848706MO
MSDS
Size $1759
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Slc14a1
Uniprot No.
Alternative Names
Slc14a1Urea transporter 1; Solute carrier family 14 member 1; Urea transporter B; UT-B; Urea transporter; erythrocyte
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-384
Target Protein Sequence
MEDSPTMVKVDRGENQILSCRGRRCGFKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILVGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSNKGDYFWWLIFPVSAMSMTCPVFSSALSSVLSKWDLPVFTLPFNMALSMYLSATGHYNTFFPSKLFTPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGGIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFEDIYFGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMAHLMAVVHLPACTWSFCLATLLFLLLTTKNPNIYRMPLSKVTYSEENRIFYLQNKKRMVESPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.
Gene References into Functions
  1. functional deficiency of all UTs caused a urea-selective urine-concentrating defect with little physiological abnormality in extrarenal organs. PMID: 27914708
  2. We conclude that transgenic expression of UT-A1 restores basal urea permeability to the level in wild-type mice but does not restore vasopressin-stimulated levels of urea permeability. This information suggests that transgenic expression of UT-A1 alone in mice lacking UT-A1 and UT-A3 is sufficient to restore urine-concentrating ability PMID: 26407594
  3. These results demonstrate that the descending thin limb (DTL) of the intermediate loop is composed of type I epithelium and expresses both UT-A2. The functional role of the DTL of the intermediate loop may be distinct from the short or long loops. PMID: 27091563
  4. Studies indicate that expression of urea transporter UT-B confers high urea permeability to erythrocytes. PMID: 25298342
  5. Studies indicate that urea transporter Slc14a1 UT-B is an indispensable transporter involved in maintaining physiological functions in different tissues. PMID: 25298344
  6. Data suggest that urea transporter UT-B may play an important role in protecting bladder urothelium by balancing intracellular urea concentration. PMID: 24204711
  7. Thienoquinoline PU-14 is a selective UT inhibitor and has urea-selective diuretic activity. PMID: 23486518
  8. AQP9 and unidentified UT-A urea channels constitute primary but redundant urea facilitators in murine hepatocytes PMID: 23042941
  9. Urea transporter-B-null mice showed defective urine concentrating ability. PMID: 22289137
  10. UT-B null mice exhibited depression-like behavior, with urea accumulation, nitric oxide reduction, and selective neuronal nitric oxide synthase level increase in hippocampus. PMID: 21750947
  11. UT-A2 deletion in UT-B knockout mice partially remedies the urine concentrating defect caused by UT-B deletion. PMID: 21849488
  12. UT-B has a role in urinary concentrating ability in mice PMID: 12133842
  13. potassium depletion is associated with reduced expression of UT-A1, UT-A3, and UT-B but increased expression of UT-A2 PMID: 12952854
  14. UT-B-deficient mice reveal that countercurrent exchange of urea in renal medullary vessels and red blood cells accounts for a major part of the kidney's concentrating ability and for the adaptation of renal urea handling during a high-protein intake. PMID: 12965892
  15. UT-B null mice have a normal glomerular filtration rate but moderately reduced urea clearance PMID: 15821253
  16. This review focuses on the erythrocyte urea transporter UT-B. PMID: 17264984
  17. UT-B plays an important role in eliminating urea produced by Sertoli cells and UT-B deletion causes both urea accumulation in the testis and early maturation of the male reproductive system. PMID: 17475664
  18. Data indicate that UT-B deletion caused the dynamic expression regulation of TNNT2 and ANP, and these proteins may provide new clues to investigate the molecular events involved in cardiac conduction. PMID: 19132680
  19. Results provide the first evidence that UT-B deletion causes progressive heart block in mice. PMID: 19471871

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Note=Restricted to the basolateral membrane in various portions of the urothelium.
Protein Families
Urea transporter family
Tissue Specificity
Expressed in brain, kidney, heart, liver, lung, skeletal muscle, spleen, testis, ureter and urinary bladder (at protein level). Along the gastrointestinal tract, detected in colon, jejunum and stomach (at protein level). In the kidney, expressed in some m
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*