Recombinant Mouse Vasoactive intestinal polypeptide receptor 1(Vipr1)

Code CSB-CF025859MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P97751
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence ASPHQECEYLQMIEKQRQQCLEEAQLENETTGCSKMWDNLTCWPTTPWGQVVVLDCPLIF QLFSPIHGYNISRNCTEEGWSQLEPGPYHIACGLNDRASSMDEQQQTEFYDAVKTGYTIG YSLSLASLLVAMAILSLFRKLHCTRNYIHMHLFMSFILRATAVFIKDMALFNNGETDHCS EASVSCKAAVVFFQYCVMANFFWLLVEGLYLHTLLAVSFFSERKYFWGYILIGWGVPSVF IMIWTIVRIHFEDFGCWDTIINSSLWWIIKGPILISILVNFILFICIIRILVQKLRPPDI GKNDSSPYSRLAKSTLLLIPLFGVHYVMFAFFPDNFKAQVKMVFELVVGSFQGFVVAILY CFLNGEVQAELRRKWRRWHLQGVLGWSSKSQHPWGGSNGVSCSTQVSMLTRVSPSARRSS SFQAEVSLV
Source in vitro E.coli expression system
Gene Names Vipr1
Protein Names Recommended name: Vasoactive intestinal polypeptide receptor 1 Short name= VIP-R-1 Alternative name(s): Pituitary adenylate cyclase-activating polypeptide type II receptor Short name= PACAP type II receptor Short name= PACAP-R
Expression Region 31-459
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Database Links

KEGG: mmu:22354

STRING: 10090.ENSMUSP00000035115

UniGene: Mm.282007

Related Products

Vipr1 Proteins

Vipr1 Proteins for Mus musculus (Mouse)

Vipr1 ELISA Kit

Vipr1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.