Recombinant Mouse Vasoactive intestinal polypeptide receptor 1 (Vipr1)

Code CSB-CF025859MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Vipr1
Uniprot No.
Alternative Names
Vipr1; Vasoactive intestinal polypeptide receptor 1; VIP-R-1; Pituitary adenylate cyclase-activating polypeptide type II receptor; PACAP type II receptor; PACAP-R-2; PACAP-R2; VPAC1
Species
Mus musculus (Mouse)
Expression Region
31-459
Target Protein Sequence
ASPHQECEYLQMIEKQRQQCLEEAQLENETTGCSKMWDNLTCWPTTPWGQVVVLDCPLIF QLFSPIHGYNISRNCTEEGWSQLEPGPYHIACGLNDRASSMDEQQQTEFYDAVKTGYTIG YSLSLASLLVAMAILSLFRKLHCTRNYIHMHLFMSFILRATAVFIKDMALFNNGETDHCS EASVSCKAAVVFFQYCVMANFFWLLVEGLYLHTLLAVSFFSERKYFWGYILIGWGVPSVF IMIWTIVRIHFEDFGCWDTIINSSLWWIIKGPILISILVNFILFICIIRILVQKLRPPDI GKNDSSPYSRLAKSTLLLIPLFGVHYVMFAFFPDNFKAQVKMVFELVVGSFQGFVVAILY CFLNGEVQAELRRKWRRWHLQGVLGWSSKSQHPWGGSNGVSCSTQVSMLTRVSPSARRSS SFQAEVSLV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. This study demonstrated that VPAC1 receptor (Vipr1)-deficient mice exhibit ameliorated experimental autoimmune encephalomyelitis, with specific deficits in the effector stage. PMID: 27357191
  2. VPAC1R mRNA expression was significantly decreased 3 days after ischemia induced by bilateral common carotid artery occlusion PMID: 22669509
  3. Cyclophosphamide-induced cystitis decreased VPAC1 receptor transcript expression in the urothelium of WT (4 h, 48 h, & chronic) & NGF-OE mice. PMID: 22700375
  4. Data support the notion that both VPAC1 and VPAC2 receptors are dynamically regulated by Ikaros, a master transcriptional regulator for thymocyte differentiation, during early thymic development. PMID: 21878358
  5. Homozygous deletion of VPAC1 resulted in fetal, neonatal, and postweaning death owing to failure to thrive, intestinal obstruction, and hypoglycemia. PMID: 21697765
  6. VPAC(1)-R activation aggravates atherosclerotic lesion formation in apolipoprotein E-deficient mice through enhanced inflammatory activity in the vessel wall. PMID: 20951679
  7. VIP and its receptors (VPAC1, VPAC2) were identified in type II taste cells of the taste bud, and VIP knockout mice exhibit enhanced taste preference to sweet tastants. PMID: 20150284
  8. In contrast, selective VPAC(1) receptor activation shifts NSPC fate toward granule cell neurogenesis without any trophism. PMID: 19650041
  9. VPAC1 suggested as mediator of the neuroprotective effects of VIP PMID: 11859927
  10. VIP modulation of neural crest differentiation is mediated via VPAC1 and high expression of VPAC1 induces differentiation in and decreases tumorigenicity of neuroblastoma cells. PMID: 12409228
  11. VIP attenuated the experimental acute pancreatitis enzymatically and morphologically by inhibiting proinflammatory cytokine production from monocytes mainly through the VPAC1-R. PMID: 15632701
  12. In neonatal mice, a defect occurs in the signal transduction mechanism of the VPAC-1 VIP receptor and cortical astrocytes from neonatal brains are dysfunctional. PMID: 17401158
  13. VIP inhibits beta-amyloid protein (Abeta)-induced neurodegeneration by indirectly inhibiting production of a wide panel of inflammatory and neurotoxic agents by activated microglia cells. PMID: 18442091
  14. Data show that VIP and its receptors, VPAC1R and VPAC2R, are expressed in hippocampus, cortex, amygdala and hypothalamus which are involved in learned behaviors. PMID: 18616823

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1