Recombinant Mouse Zinc transporter 8 (Slc30a8)

In Stock
Code CSB-CF807333MO
Abbreviation Recombinant Mouse Slc30a8 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Slc30a8; Znt8; Zinc transporter 8; ZnT-8; Solute carrier family 30 member 8
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-367aa
Target Protein Sequence
MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Zinc transporter 8 (Slc30a8) is produced through an in vitro E.coli expression system and includes the complete protein spanning amino acids 1 to 367. The protein features an N-terminal 10xHis tag that simplifies purification and detection processes. SDS-PAGE analysis confirms the product achieves purity levels above 85%, which appears to provide reliable performance for research work.

Zinc transporter 8 (Slc30a8) represents a key protein in regulating zinc ion movement across cellular membranes. Its role in maintaining zinc homeostasis seems critical for numerous cellular functions. The protein shows particular importance in pancreatic beta cells, where it likely contributes to insulin secretion and glucose metabolism. This makes it an increasingly important target for metabolic research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Slc30a8 is a eukaryotic transmembrane protein that requires precise folding, membrane integration, and zinc-binding domain formation for its functional activity. The in vitro E. coli expression system (cell-free system) provides a simplified environment without cellular compartmentalization, which is particularly challenging for transmembrane proteins that require integration into lipid membranes. While cell-free systems can produce soluble proteins, they cannot provide the necessary membrane environment for proper folding and integration of transmembrane proteins like Slc30a8. The probability of correct folding with functional zinc transport activity is very low.

1. Antibody Development and Validation

Antibody development against linear epitopes relies primarily on antigenic sequence recognition rather than native folding. This recombinant Slc30a8 serves as a suitable immunogen for generating antibodies against linear epitopes of mouse zinc transporter 8. The full-length sequence provides comprehensive epitope coverage. However, since the protein likely lacks proper membrane integration and tertiary structure, antibodies may not efficiently recognize the native, membrane-integrated form in physiological contexts.

2. Biochemical Characterization and Binding Studies

Basic biophysical characterization of the soluble protein is possible, but functional zinc binding or transport studies are not feasible. Cell-free systems cannot provide the membrane environment required for functional transmembrane protein studies. Techniques like circular dichroism can analyze secondary structure content, but the protein will lack the proper membrane association needed for physiological zinc binding.

3. Comparative Species Analysis

This protein can be used for sequence-based comparisons and immunological cross-reactivity studies of the soluble domains. However, functional comparative analyses of zinc transport would be invalid due to the lack of proper membrane integration.

Final Recommendation & Action Plan

The in vitro E. coli expression system is fundamentally unsuitable for producing functional transmembrane proteins like Slc30a8 that require membrane integration. This recombinant protein is primarily suitable for antibody development against linear epitopes (Application 1) and basic characterization of soluble domains (limited aspects of Application 2). Transmembrane protein interactions require proper membrane topology and context that cannot be achieved in cell-free expression systems. For reliable zinc transporter research, use mammalian expression systems with proper membrane environments or purified membrane preparations that support correct protein folding and activity. Begin with basic biophysical characterization to assess the protein's soluble properties, then proceed with linear epitope antibody development. For functional studies, consider alternative expression systems that provide the necessary membrane context for proper protein folding and zinc transport activity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Gene References into Functions
  1. Knockin mouse model suggests that the SLC30A8 R138X loss-of-function mutation may exert beneficial effects on glucose metabolism by increasing the capacity of beta-cells to secrete insulin under hyperglycemic conditions. PMID: 30038024
  2. These data demonstrate that the function of ZnT8 in islets can be unmasked by removal of ZnT7 and imply that ZnT8 may affect T2D susceptibility through actions in other tissues where it is expressed at low levels rather than through effects on pancreatic islet function. PMID: 27754787
  3. Our findings demonstrate that glucose homeostasis in the mouse improves as beta-cell ZnT8 activity increases, and remarkably, these changes track Zn(2+) rather than insulin release in vitro. PMID: 26584158
  4. Deletion of ZnT8 in a limited subset ( approximately 15%) of alpha-pancreatic cells is sufficient to increase glucagon secretion at low glucose concentrations in vitro and in vivo and to improve the response to hypoglycemia. PMID: 26178371
  5. ischemic retinopathy maybe mediated by aberrant Zn(++) homeostasis caused by ZnT8 downregulation, whereas YC-1 plays a neuroprotective role against ischemic insult PMID: 23209723
  6. Data suggest that, despite a marked reduction in islet zinc content, the absence of ZnT-8 does not have a substantial impact on mouse physiology. PMID: 22829903
  7. Beta-cell Znt8 alone does not considerably aggravate weight gain and glucose intolerance during metabolic stress imposed by an high-fat high-calorie diet. Global loss of Znt8 is involved in diet-induced obesity and resulting insulin resistance. PMID: 22338079
  8. Downregulation of ZnT8 may be associated with impaired function of beta-cells in diabetes. PMID: 21099260
  9. Mutation of two Pdx-1-binding sites in enhancer A markedly reduces fusion gene expression suggesting that this factor contributes to Slc30a8 expression in beta-c PMID: 20942803
  10. Our data indicate that while, under the conditions studied, ZnT8 is absolutely essential for proper beta cell function, it is largely dispensable for alpha cell function. PMID: 20424817
  11. Results suggest that an acute decrease in ZnT8 levels impairs beta-cell function and Zn homeostasis, and may contribute to inflammatory cytokine-induced alterations in beta-cell function. PMID: 20508080
  12. Diabetes-linked zinc transporter ZnT8 is a homodimeric protein expressed by distinct rodent endocrine cell types in the pancreas and other glands. PMID: 19095428
  13. Slc30a8 gene deletion is accompanied by a modest impairment in insulin secretion without major alterations in glucose metabolism. PMID: 19450229
  14. ZnT8 is required for normal insulin crystallization and insulin release in vivo but not, remarkably, in vitro PMID: 19542200
  15. ZnT8 transporter is essential for the formation of insulin crystals in beta cells, contributing to the packaging efficiency of stored insulin. PMID: 19706465

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Tissue Specificity
Expressed in endocrine pancreatic islet alpha and beta cells. Not detected in the brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*