Recombinant Organic solute transporter alpha-like protein C01B12.4 (C01B12.4)

Code CSB-CF517701CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O17204
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MEIVKTIIPHNRSYIEPPIPSATEWLANMSVMHVSCLTIACVFVAITFLSSFFHLFFVLK YVSNERIRNDMYALIFMFPITTFASLVGMFIPRAAIFLYAVSLVYFMFTLFIMVTLLFNI FGGRQEMSAYLLQRNIRVNFTVPPLCFFKFLPTVESTDQNLRRIEWLVFQTPIIRTLLEL VSVVVSMEQEGRRESVWFVFSQLMALLSMCIAFYGCYVMVPLGREKHAPYRFDFLFRTCD IAQCIYTIQKFVFEFAAAVGLITSDRYLPAAAKALWWASFMCTWEMMLLSALCSYCLRPA KCKFFDLYPGNDMPALSARDGSNSRVPSFSRRLSIEYEPRIAGVMLEPPSRSSLSITPRD KIEDPTTVSYFADNFDSLSQIQGQ
Source in vitro E.coli expression system
Gene Names osta-1
Protein Names Recommended name: Organic solute transporter alpha-like protein C01B12.4
Expression Region 1-384
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable transporter.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families OST-alpha family
Database Links

KEGG: cel:CELE_C01B12.4

STRING: 6239.C01B12.4

UniGene: Cel.16018

Related Products

osta-1 Antibodies

osta-1 Antibodies for Caenorhabditis elegans

osta-1 Proteins

osta-1 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.