Recombinant Organic solute transporter alpha-like protein W01D2.5(W01D2.5)

Code CSB-CF895483CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9XU63
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MAKEHGAMRSVLNLIGSVMLPQDTSNCSDRHDTPSAPEFLSHLQPFQTVLLSIASFSTTI VLCLSLIHWFYVYKYVSIEKRRNKLYWLIAVFPVACSCSFIAMCVPRTAVILTCIGVLYY LMCLFVIVSLARHLFGGRESFSTCLQYDDRPIDFRSPPFCCIIPKLPTARSTEKNIRRLE WCVLQAPIVRSIIIFLDVVAVAEMREDATPYIRYSDMASLCSLLLAIFGVHTLARVTSNK LSAYCFMSMFRLVDISLLFFSAQQPMIFQNVLLRFNLISCGPLLNAQENAYFVCNFIITC EMLLLSVLATWLLAPRHNAMFDAYRPSMALSETTASLNETEQSMILDH
Source in vitro E.coli expression system
Gene Names osta-3
Protein Names Recommended name: Organic solute transporter alpha-like protein W01D2.5
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable transporter.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families OST-alpha family
Database Links

KEGG: cel:CELE_W01D2.5

UniGene: Cel.14239

Related Products

osta-3 Antibodies

osta-3 Antibodies for Caenorhabditis elegans

osta-3 Proteins

osta-3 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.