Recombinant Organic solute transporter alpha-like protein W01D2.5(W01D2.5)

Code CSB-CF895483CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9XU63
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Caenorhabditis elegans
Sequence MAKEHGAMRSVLNLIGSVMLPQDTSNCSDRHDTPSAPEFLSHLQPFQTVLLSIASFSTTI VLCLSLIHWFYVYKYVSIEKRRNKLYWLIAVFPVACSCSFIAMCVPRTAVILTCIGVLYY LMCLFVIVSLARHLFGGRESFSTCLQYDDRPIDFRSPPFCCIIPKLPTARSTEKNIRRLE WCVLQAPIVRSIIIFLDVVAVAEMREDATPYIRYSDMASLCSLLLAIFGVHTLARVTSNK LSAYCFMSMFRLVDISLLFFSAQQPMIFQNVLLRFNLISCGPLLNAQENAYFVCNFIITC EMLLLSVLATWLLAPRHNAMFDAYRPSMALSETTASLNETEQSMILDH
Source in vitro E.coli expression system
Gene Names osta-3
Protein Names Recommended name: Organic solute transporter alpha-like protein W01D2.5
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable transporter.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families OST-alpha family
Database Links

KEGG: cel:CELE_W01D2.5

UniGene: Cel.14239

Related Products

osta-3 Antibodies

osta-3 Antibodies for Caenorhabditis elegans

osta-3 Proteins

osta-3 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.