Recombinant Oryza sativa subsp. indica Chlorophyll a-b binding protein, chloroplastic (OsI_012078)

Code CSB-CF384880OFF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A2XJ35
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. indica (Rice)
Sequence RRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNREL EVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSI LAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNG RLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK
Source in vitro E.coli expression system
Gene Names OsI_012078
Protein Names Recommended name: Chlorophyll a-b binding protein, chloroplastic Alternative name(s): LHCII type I CAB Short name= LHCP
Expression Region 36-263
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.
Subcellular Location Plastid, chloroplast thylakoid membrane, Multi-pass membrane protein
Protein Families Light-harvesting chlorophyll a/b-binding (LHC) protein family
Database Links

STRING: 39946.BGIOSGA013052-PA

Related Products

OsI_012078 Antibodies

OsI_012078 Antibodies for Oryza sativa subsp. indica (Rice)

OsI_012078 Proteins

OsI_012078 Proteins for Oryza sativa subsp. indica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.