Recombinant Oryza sativa subsp. indica Probable polyprenol reductase 2 (OsI_26070)

Code CSB-CF490880OFF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B8B6G5
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. indica (Rice)
Sequence MESEGWPALQPLLCFAWIAATLPIIAAALPIPTAVGGHLLRRLLSAFSSRGKTVRPSPAS SSGSSSSKAKFTVPQKYFMHFYVVGVLATTILLLAIWFYAYMKLTPLLLESSSYSTIFSH LVGSNSFSFGRVRSRTMGHKYRVWRTVFALLLMEVQVLRRLYETEHVFHYSPARMHIVGY LTGLFYYVAAPLSLASSCIPEAAEYFQGQVPEFVVKGRARMPDLVIDSSSLLQPLLKLGW TQWIGAVIFIWGSLHQIRCHAILGSLREHKDSDEYVIPCSDCFNRVSCPHYLAELVIYFG MLVASGAEDIPVWFLFIFLITNLSFAAVETYNWYLQKFEDYPRSRYAIIPFVC
Source in vitro E.coli expression system
Gene Names OsI_26070
Protein Names Recommended name: Probable polyprenol reductase 2 EC= 1.3.1.-
Expression Region 1-353
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Database Links

STRING: 39946.BGIOSGA025736-PA

Related Products

OsI_26070 Antibodies

OsI_26070 Antibodies for Oryza sativa subsp. indica (Rice)

OsI_26070 Proteins

OsI_26070 Proteins for Oryza sativa subsp. indica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.