Recombinant Oryza sativa subsp. indica Putative UPF0496 protein 2 (OsI_023618)

Code CSB-CF383736OFF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A2YH25
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. indica (Rice)
Sequence MIERSNSTPSATPVRPPLAVDEEYNQAFRSKSFLDLWSHAHHHLTHTFSSFKLSTSTPCA GRGGAREDDFLHAGGDGGAADDSEQSCSYTVLDDFVLEPSPESLARGARLQQRRRRRPRR HRVETLLIEYFDVTEEACEACSALLAAIGAARRHHLTLRRLLLRLDGGDDDDAKDALARH VRLDNPLSPGSLSEFHDVHARCSPLASRLAAAQRRLRRLARALRIARGTAAAALVGACAA AIVAAVVLAAHALVGIGVAAAAFGATPAGAARWWARRAAEKVSSRHYARAGATLDAAARG AYIVGRDLDTVSRMVRRAHDELEHGRDVARIAMRGHGERPLLQEVAREEEECEEDLRAQL AELEEHVCLCLITINRTRRLVAHEMARGLPPPSPATVTTTSEERLTSS
Source in vitro E.coli expression system
Gene Names OsI_023618
Protein Names Recommended name: Putative UPF0496 protein 2
Expression Region 1-408
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families UPF0496 family

Related Products

OsI_023618 Antibodies

OsI_023618 Antibodies for Oryza sativa subsp. indica (Rice)

OsI_023618 Proteins

OsI_023618 Proteins for Oryza sativa subsp. indica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.