Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET16(SWEET16)

Code CSB-CF612035OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q10LN5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Oryza sativa subsp. japonica (Rice)
Sequence MADPSFFVGIVGNVISILVFASPIATFRRIVRSKSTEEFRWLPYVTTLLSTSLWTFYGLH KPGGLLIVTVNGSGAALEAIYVTLYLAYAPRETKAKMVKVVLAVNVGALAAVVAVALVAL HGGVRLFVVGVLCAALTIGMYAAPMAAMRTVVKTRSVEYMPFSLSFFLFLNGGVWSVYSL LVKDYFIGIPNAIGFALGTAQLALYMAYRRTKKPAGKGGDDDEDDEEAQGVARLMGHQVE MAQQRRDQQLRKGLSLSLPKPAAPLHGGLDRIIKSFSTTPIELHSILHQHHGGHHHHHRF DTVPDDDDEAVAAGGTTPATTAGPGDRH
Source in vitro E.coli expression system
Gene Names SWEET16
Protein Names Recommended name: Bidirectional sugar transporter SWEET16 Short name= OsSWEET16
Expression Region 1-328
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families SWEET sugar transporter family
Database Links

KEGG: osa:4332795

UniGene: Os.59776

Related Products

SWEET16 Antibodies

SWEET16 Antibodies for Oryza sativa subsp. japonica (Rice)

SWEET16 Proteins

SWEET16 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.