Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os03g0188200(Os03g0188200, LOC_Os03g08920)

Code CSB-CF810190OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8H7N9
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MAHRRIALAVLVTLLLSAFRPCLAQQSNDDTSKHHRSATAGGFTPTTVVVLVALITAFVL LTVFSVLINRCAQARAPPRRAFRSTASHQPVGGAAAASRASRGLDKEVVEAFPTAVYGDV KARMAAKSGPLECAVCLAEFADSDELRVLPACCHVFHPDCIDPWLAAAVTCPLCRANLTA PPVSLAAAESSDLTAPEEAVQEEESEELDEASLMATFTPESVIDFGATHDHEFDRAGYPH YRRTQSAMDAAPDRHTLRLPEHVMKELAADRRHRRAASLAGYPDSVERTPRWLTSLWRSV SWQRQSRADWDAGEEHGGSKRVHPVAGAQDETPSGSGSDGSKENSDSDALNRV
Source in vitro E.coli expression system
Gene Names Os03g0188200
Protein Names Recommended name: E3 ubiquitin-protein ligase Os03g0188200 EC= 6.3.2.- Alternative name(s): RING-H2 finger protein Os03g0188200
Expression Region 1-353
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Possesses E3 ubiquitin-protein ligase in vitro.
Subcellular Location Membrane, Single-pass membrane protein
Database Links

KEGG: osa:4331886

STRING: 39947.LOC_Os03g08920.1

UniGene: Os.37432

Related Products

Os03g0188200 Antibodies

Os03g0188200 Antibodies for Oryza sativa subsp. japonica (Rice)

Os03g0188200 Proteins

Os03g0188200 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.