Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os04g0590900(Os04g0590900, LOC_Os04g50100)

Code CSB-CF770276OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7XLY8
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MASSAPAWVPYEPTRDCSQGLCSMYCPQWCYFIFPPPPPFDVAGTSADDSSGPVFSPLVI AIIGVLASAFLLVSYYTFISKYCGTVSSLRGRVFGSSSGGAAYGGGAGSGGRHGHGQSRS HESWNVSPPSGLDETLINKITVCKYRRGDGFVHTTDCSVCLGEFSDGESLRLLPRCSHAF HQQCIDTWLKSHSNCPLCRANITFVTVGLASPEPEGCAPGETGGDNTHEVVVVMDGLENL CEEQQEAVSRASTADDDHDAKDVAEGMEEANGAAEIREEGSPPKRGASSFDLHRDNRMCI ADVLQESMEDELTAARESGLLAGGAGTSRRCHGENSKGRGGRSRRALQLQDAMEALPGKR LPSGGRSCFSSKSGRGKDSDHPM
Source in vitro E.coli expression system
Gene Names Os04g0590900
Protein Names Recommended name: E3 ubiquitin-protein ligase Os04g0590900 EC= 6.3.2.- Alternative name(s): RING-H2 finger protein Os04g0590900
Expression Region 1-383
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Possesses E3 ubiquitin-protein ligase in vitro.
Subcellular Location Membrane, Single-pass membrane protein
Database Links

KEGG: osa:4336823

STRING: 39947.LOC_Os04g50100.1

UniGene: Os.52382

Related Products

Os04g0590900 Antibodies

Os04g0590900 Antibodies for Oryza sativa subsp. japonica (Rice)

Os04g0590900 Proteins

Os04g0590900 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.