Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os06g0535400(Os06g0535400, LOC_Os06g34450)

Code CSB-CF736538OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5Z5F2
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MELPWLDLPFTLLTLLLATRLAYDYYGVVAATFTGSFSLQIFLFYCFARWYRHTIAARAA ADADGDGGGGAVADEEAAPPVLIPLLEGRGGGGGGAGAASSLANRCFAVVFMVFVPLVIV VFERSQADVVAYALCLANILVMVVWLSPDAAADPASAAKSFLRLSDDEDEGSCSGSGHGA AEDKCCVCLAGMREAQALRDLPRCGHRFHAKCIGKWLTAHPTCPVCRTTAVPPPAPLPAS GDHADDAITPV
Source in vitro E.coli expression system
Gene Names Os06g0535400
Protein Names Recommended name: E3 ubiquitin-protein ligase Os06g0535400 EC= 6.3.2.- Alternative name(s): RING-H2 finger protein Os06g0535400
Expression Region 1-251
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Possesses E3 ubiquitin-protein ligase in vitro.
Subcellular Location Membrane, Multi-pass membrane protein
Database Links

KEGG: osa:4341214

STRING: 39947.LOC_Os06g34450.1

UniGene: Os.5874

Related Products

Os06g0535400 Antibodies

Os06g0535400 Antibodies for Oryza sativa subsp. japonica (Rice)

Os06g0535400 Proteins

Os06g0535400 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.