Recombinant Oryza sativa subsp. japonica Phosphate transporter PHO1-1(PHO1-1)

Code CSB-CF731155OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q657S5
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MVKFSKQFEGQLVPEWKHAFVDYSLLKKDLKRMQHDYSPQGTIITTSTPHDHHQQQQSVA APSSYNLSHCRLLLHKLPAAFFGSNNADHAGAIQVRRRVGRGEVYETEVTPEMETTAATA AREFFARLDAQLNKVNHFYKAKEEEFLHRGHSLRKQMDILLDLKSRSSSSLSGHHRAAAG DDPSISSSSATSGAEDESTRYVTSATDTDESQHETAVMRDPEELSAEQGLEDSGSLSRQS LGRTVSSCQRKNLKINIPLTTPCRTISALTDLLRDDLVSQPKNKCDSDAGITFTTINKTK LRHAEKMIKGAFIELYKGLGYLTTYRNLNMMAFVKILKKFEKVSGKQVLSVYLRAVESSY FNSSGEALKLMDEVEDVFVRHFAAGNRRKAMKYLKPTQRKESHTVTFFIGLMTGCFVALF LGYCIMAHIAGMYTQRRDSIYMETVYPVFSMFSLMFLHLFMYGCNMVAWRKARINYSFIF EFAAGRELKYRDVFLVCTASMAVIVGVMFAHLSLAVRGFHAQAIPGFLLLGFLLLLFCPF NMVYRSTRFQFLRILRNIVFSPLYKVVMVDFFMADQLCSQVPMLRSLEYVACYYISGSYR TQEYGYCINTKHIRDLAYAVSFLPYYWRAMQCARRWFDESDTGHLVNLGKYVSAMLAAGA KVAYEKDRSLGSLSLLVIVSSSATMYQLYWDFVKDWGLLQPNSKNPWLRNDLILKSKSIY YLSMGLNLVLRLAWLQTVIHPNFGSLDSRVTSFFLAALEVIRRGHWNFYRLENEHLNNAG KFRAVKTVPLPFHEADEED
Source in vitro E.coli expression system
Gene Names PHO1-1
Protein Names Recommended name: Phosphate transporter PHO1-1 Alternative name(s): Protein PHO1-1 Short name= OsPHO1;1
Expression Region 1-799
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May transport inorganic phosphate (Pi).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families SYG1 (TC 2.A.94) family
Tissue Specificity Expressed in roots and flowers.
Database Links

KEGG: osa:9270401

STRING: 39947.LOC_Os01g02000.1

UniGene: Os.69803

Related Products

PHO1-1 Antibodies

PHO1-1 Antibodies for Oryza sativa subsp. japonica (Rice)

PHO1-1 Proteins

PHO1-1 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.