Recombinant Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 3, chloroplastic(PPT3)

Code CSB-CF726108OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5VQL3
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence VAAAEAPLPADDADAAAGRERGALAETAQLGAMIVAWYLLNIYFNIYNKQVLQPLPFPYT ITAFQLAFGSFVIFLMWALKLHPAPRISISQLAKIAPLAAGHMLGTVFTNMSLSKVAVSF THTIKASEPFFTVLLSAFFLGETPSLLVLGSLVPIVGGVALASLTELSFNWIGFWSAMAS NLLYQSRNVLSKKLLGGEEEALDDINLFSILTILSFLLSLPLMLFSEGVKFSPGYLRSTG LNLQELCVRAALAGFCFHGYQKLSYLILARVSPVTHSVANCVKRVVVIVASVLFFRTPIS PVNALGTGVALGGVFLYSRLKRTKPKNA
Source in vitro E.coli expression system
Gene Names PPT3
Protein Names Recommended name: Phosphoenolpyruvate/phosphate translocator 3, chloroplastic Short name= OsPPT3
Expression Region 66-393
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate.
Subcellular Location Plastid, chloroplast membrane, Multi-pass membrane protein
Protein Families TPT transporter family, PPT (TC 2.A.7.9) subfamily
Database Links

KEGG: osa:4327644

STRING: 39947.LOC_Os01g07730.1

UniGene: Os.51043

Related Products

PPT3 Antibodies

PPT3 Antibodies for Oryza sativa subsp. japonica (Rice)

PPT3 Proteins

PPT3 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.