Recombinant Oryza sativa subsp. japonica Probable polyprenol reductase 2(Os07g0493400, LOC_Os07g31140)

Code CSB-CF765913OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7F0Q2
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MESEGWPALQPLLCFAWIAATLPIIAAALPIPTAVGGHLLRRLLSAFSSRGKTVRPSPAS SSGSSSSKAKFTVPQKYFMHFYVVGVLATTILLLAIWFYAYMKLTPLLLESSSYSTIFSH LVGSNSFSFGRVRSRTMGHKYRVWRTVFALLLMEVQVLRRLYETEHVFHYSPARMHIVGY LTGLFYYVAAPLSLASSCIPEAAEYFQGQVPEFVVKGRARMPDLVIDSSSLLQPLLKLGW TQWIGAVIFIWGSLHQIRCHAILGSLREHKDYDEYVIPCGDCFNRVSCPHYLAELVIYFG MLVASGAEDIPVWFLFIFVITNLSFAAVETYNWYLQKFEDYPRSRYAIIPFVC
Source in vitro E.coli expression system
Gene Names Os07g0493400
Protein Names Recommended name: Probable polyprenol reductase 2 EC= 1.3.1.-
Expression Region 1-353
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Database Links

KEGG: osa:4343281

STRING: 39947.LOC_Os07g31140.1

UniGene: Os.72632

Related Products

Os07g0493400 Antibodies

Os07g0493400 Antibodies for Oryza sativa subsp. japonica (Rice)

Os07g0493400 Proteins

Os07g0493400 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.