Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 10(Os02g0149800, LOC_Os02g05630)

Code CSB-CF721190OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q67UX7
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MHGRPSRPLASSSSSSSSRVFSFFLAPRVFLFLVVVVVVVFLPGRSSCWWLEGTEELEEE MGFAGDCSPVSGGGLSENGKFSYGYASAPGKRASMEDFYETRIDGVDGETIGLFGVFDGH GGARAAEYVKQHLFSNLIKHPKFISDIKSAIAETYNHTDSEFLKAESSHTRDAGSTASTA ILVGDRLLVANVGDSRAVVCRGGDAIAVSRDHKPDQSDERQRIEDAGGFVMWAGTWRVGG VLAVSRAFGDKLLKQYVVADPEIKEEIVDSSLEFLILASDGLWDVVSNKEAVDMVRPIQD PEQAAKRLLQEAYQRGSADNITVVIVRFLEGTTTGGGPSREAASDQNS
Source in vitro E.coli expression system
Gene Names Os02g0149800
Protein Names Recommended name: Probable protein phosphatase 2C 10 Short name= OsPP2C10 EC= 3.1.3.16
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families PP2C family
Database Links

KEGG: osa:4328306

STRING: 39947.LOC_Os02g05630.1

UniGene: Os.21078

Related Products

Os02g0149800 Antibodies

Os02g0149800 Antibodies for Oryza sativa subsp. japonica (Rice)

Os02g0149800 Proteins

Os02g0149800 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.