Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 5(Os01g0552300, LOC_Os01g37130)

Code CSB-CF683354OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5JKN1
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Oryza sativa subsp. japonica (Rice)
Sequence MALLSPRVPRLPLASASAAGAGLRCCVSGGRAGSAAWCHASAAGSVASSSSELEAIRWGT AKLQGARDEMEDEVVLRPGSLLDGFSFAAVFDGHAGFSAVEFLRDELYKECAAALDGGAV LSTKNLDAITDSIQRAFATVDANLSTWLEQMDKEDESGATATAMFLRNDVLVVSHIGDSC LQVVSRGGRPQAVTNFHRPYGNKKASLEEVKRIRAAGGWIVDGRICGEISVSRAFGDIRF KTRKNEMLVKGVKEGRWTEKFISRINFKGDLIVSSPDVSLVELGPDVEFVLLATDGLWDY IKSSEAVALVRDQLRQHGDVQVACEALGQIALDRRSQDNISIVIADLGRTNWKELPAQRP NLFLELTQAVATVGAVSLGIYISSLLALQ
Source in vitro E.coli expression system
Gene Names Os01g0552300
Protein Names Recommended name: Probable protein phosphatase 2C 5 Short name= OsPP2C05 EC= 3.1.3.16
Expression Region 1-389
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families PP2C family
Database Links

KEGG: osa:4325851

STRING: 39947.LOC_Os01g37130.1

UniGene: Os.15194

Related Products

Os01g0552300 Antibodies

Os01g0552300 Antibodies for Oryza sativa subsp. japonica (Rice)

Os01g0552300 Proteins

Os01g0552300 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.