Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 72(Os10g0544900, LOC_Os10g39780)

Code CSB-CF800019OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7XCJ7
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MLSAAMEYLRSCWGPASSPAGRPRKGSDAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNL LEDHSQVESGPLSTTDPNLQGTLVGVYDGHGGPETARYINDHLFNHLRGFASEHKCMSAD VIRKAFRATEEGFFSVVSSQWSMRPQLAAVGSCCLVGVICAGNLYIANLGDSRAVLGRLV KGTGEVLAMQLSAEHNASFEEVRRELQAAHPDDPHIVVLKHNVWRVKGIIQITRSIGDVY LKKPEFNREPLHSKFRLQETFRRPLLSSEPAIVVHQLQTTDQFIIFASDGLWEHISNQEA VDLVQHNPRNGIARRLVKAAMQQAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVFFDSN AITTANWSRPSVSLRGGGVTLPANSLAPFSVPT
Source in vitro E.coli expression system
Gene Names Os10g0544900
Protein Names Recommended name: Probable protein phosphatase 2C 72 Short name= OsPP2C72 EC= 3.1.3.16
Expression Region 1-393
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families PP2C family
Database Links

KEGG: osa:4349275

STRING: 39947.LOC_Os10g39780.1

UniGene: Os.3095

Related Products

Os10g0544900 Antibodies

Os10g0544900 Antibodies for Oryza sativa subsp. japonica (Rice)

Os10g0544900 Proteins

Os10g0544900 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.