Recombinant Oryza sativa subsp. japonica Probable tRNA-splicing endonuclease subunit Sen2(Os06g0530700, LOC_Os06g33980)

Code CSB-CF719971OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5Z6B1
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MDLPGPRWKKGKDGKDFASLAAANPMSAIVSELKASFISSKPVAILSGPGGSAVLGVGPE QAVILNRAAFGHAIENATAQKHWFQLSPEEVFYLCHALNCIRVDSLDNKQMSEIELWDYF RSGSESFPEMYKAYAHLRLKNWVVRSGLQYGADFVAYRHHPALVHSEFAVVVVPEGAEFG NRCGRLEVWSDLLCALRASGSVAKTLLVLTISSSSKCELSSPDCLEQLVVHERTITRWIL QQCREQRCEPSRDEVNREELIIEKESVVFNHWGVILGFTVLSGLLVYRLKFRQ
Source in vitro E.coli expression system
Gene Names Os06g0530700
Protein Names Recommended name: Probable tRNA-splicing endonuclease subunit Sen2 EC= 3.1.27.9 Alternative name(s): tRNA-intron endonuclease Sen2
Expression Region 1-293
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. Probably carries the active site for 5'-splice site cleavage (By similarity).
Subcellular Location Nucleus, Membrane, Single-pass membrane protein
Protein Families TRNA-intron endonuclease family
Database Links

KEGG: osa:4341203

STRING: 39947.LOC_Os06g33980.1

UniGene: Os.24713

Related Products

Os06g0530700 Antibodies

Os06g0530700 Antibodies for Oryza sativa subsp. japonica (Rice)

Os06g0530700 Proteins

Os06g0530700 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.