Recombinant Oryza sativa subsp. japonica Protein transport protein Sec61 subunit gamma (Os02g0178400, LOC_Os02g08180)

Code CSB-CF020959OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P38385
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Oryza sativa subsp. japonica (Rice)
Sequence MDAVDSVVDPLREFAKDSVRLVKRCHKPDRKEFTKVAARTAIGFVVMGFVGFFVKLIFIPINNIIVGSG
Source in vitro E.coli expression system
Gene Names Os02g0178400
Protein Names Recommended name: Protein transport protein Sec61 subunit gamma
Expression Region 1-69
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Necessary for protein translocation in the endoplasmic reticulum.
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families SecE/SEC61-gamma family
Database Links

KEGG: osa:4328492

STRING: 39947.LOC_Os02g08180.1

UniGene: Os.10116

Related Products

Os02g0178400 Antibodies

Os02g0178400 Antibodies for Oryza sativa subsp. japonica (Rice)

Os02g0178400 Proteins

Os02g0178400 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.