Recombinant Oryza sativa subsp. japonica Putative UPF0496 protein 2(Os06g0718300, LOC_Os06g50410)

Code CSB-CF713692OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5Z8N6
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MIERSNSTPSATPARPPLAVDEEYNQAFRSKSFLDLWSHAHHHLTHTFSSFKLSTSTPCA GRGGAREDDFLHAGGDGGAADDSEQSCSYTVLDDFVLEPSPESLARGARLQQRRRRRPRR HRVETLLIEYFDVTEEACEACSALLAAIGAARRHHLTLRRLLLRLDGGDDDDAKDALARH VRLDNPLSPGSLSEFHDVHARCSPLASRLAAAQRRLRRLARALRIARGTAAAALVGACAA AIVAAVVLAAHALVGIGVAAAAFGATPAGAARWWGRRAAEKVSSRHYARAGATLDAAARG AYIVGRDLDTVSRMVRRAHDELEHGRDVARIAMRGHGERPLLQEVAREEEECEEDLRAQL AELEEHVCLCLITINRTRRLVAHEMARGLPPPSPATVTTTSEERLTSS
Source in vitro E.coli expression system
Gene Names Os06g0718300
Protein Names Recommended name: Putative UPF0496 protein 2
Expression Region 1-408
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families UPF0496 family

Related Products

Os06g0718300 Antibodies

Os06g0718300 Antibodies for Oryza sativa subsp. japonica (Rice)

Os06g0718300 Proteins

Os06g0718300 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.