Recombinant Oryza sativa subsp. japonica Putative UPF0496 protein 5(Os10g0359200, LOC_Os10g21540)

Code CSB-CF773510OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7XFE1
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MGNRHGIMRPRRLASGRSAAEEEEDGEGEPGSYEAACSADPELGTFDTALRRRASRAITA VASGVEVRSLSLGSLREVTGCLLDMNQEVVRVVLDCKRDVWRSPDLFDLVEDYFEGSLHT LDFLAALDKSLHRARDSQLVLHLALQRHHHEPPAAASASELYASTLGELRQFKAAGEPFT DEFFAAFQTVYRQQMSMVGKLRRRKRRLDRRLRSVRVWRRVSGIVFLTSFAALLVCSVVA AAIAAPPVAAALAAAASMPVGSAGKWMDSLLKKYQDALHGHKEVVSAMQVGTFIAIKDLD SIRVLVEHLEVQISSMADSVEFAERDEEAVRFGIDEVKKKLELFMKSVDDLGEQADRNNM RMCHILPEYVFFINLANGNGMSESLFEMMNAFHDICRKDIKFKTSHYYLNFLSSSYQVYI AVA
Source in vitro E.coli expression system
Gene Names Os10g0359200
Protein Names Recommended name: Putative UPF0496 protein 5
Expression Region 1-423
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families UPF0496 family
Database Links

KEGG: osa:107277196

Related Products

Os10g0359200 Antibodies

Os10g0359200 Antibodies for Oryza sativa subsp. japonica (Rice)

Os10g0359200 Proteins

Os10g0359200 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.