Recombinant Oryza sativa subsp. japonica UPF0496 protein 3(Os03g0148000, LOC_Os03g05440)

Code CSB-CF612046OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q10RR9
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MGATFRCFGGCVKPDDQQVHEPKKVVAPSSSFDFREEYTSAFRTESYNDFWARVLDITLA HGAALVPRHGGGGGCAASKRLPSYRLFAEHLLEPDQRAVAAALASPRGSRLRPDVRGLLA AYYAETANASFLCSHLLKDIEHIRLRYRPLKHTLRKLASDVGVSGLADVSAALGQPFTAL AASQGRLREVQAGSGDLLRGLDAGRKKARHRIRSVARLRRALSVSFVTAVAVVAVVGACI GVHILAAFAAFPMMSPAWLGERFFSGRAARRALVQLEAAAKGTYILNRDMETISRLVARV RDEGEHMVALRRLCVEHRPAAGAGGKGRLVQEVLRQLSKNEESFRQQLDELEEHLFLCFM TTNKARIMVMNFMAAAAR
Source in vitro E.coli expression system
Gene Names Os03g0148000
Protein Names Recommended name: UPF0496 protein 3
Expression Region 1-378
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families UPF0496 family
Database Links

KEGG: osa:4331620

UniGene: Os.56829

Related Products

Os03g0148000 Antibodies

Os03g0148000 Antibodies for Oryza sativa subsp. japonica (Rice)

Os03g0148000 Proteins

Os03g0148000 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.