Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter 1.2(VIT1.2)

Code CSB-CF721963OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6ERE5
Storage Buffer Tris-based buffer,50% glycerol
Species Oryza sativa subsp. japonica (Rice)
Sequence MVKEFVQDEEKQRLLLDEHTEKHFTAGEVVRDIIIGVSDGLTVPFALAAGLSGANAPSAL VLTAGLAEVAAGAISMGLGGYLAAKSDADHYHRELQREQEEIDTVPDTEAAEIADILSQY GLGPEEYGPVVNSLRSNPKAWLEFMMKFELGLEKPEPRRALMSAGTIALAYVVGGLVPLL PYMFVPTADRAMATSVVVTLAALLFFGYVKGRFTGNRPFISAFQTAVIGALASAAAFGMA KAVQSI
Source in vitro E.coli expression system
Gene Names VIT1.2
Protein Names Recommended name: Vacuolar iron transporter 1.2 Short name= OsVIT1.2
Expression Region 1-246
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable vacuolar iron transporter that may be involved in the transfer of iron from the cytosol to the vacuole for intracellular iron storage.
Subcellular Location Vacuole membrane, Multi-pass membrane protein
Protein Families CCC1 family
Database Links

KEGG: osa:4346978

STRING: 39947.LOC_Os09g23300.1

UniGene: Os.9660

Related Products

VIT1.2 Antibodies

VIT1.2 Antibodies for Oryza sativa subsp. japonica (Rice)

VIT1.2 Proteins

VIT1.2 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.