Recombinant Pan troglodytes Probable G-protein coupled receptor 34(GPR34)

Code CSB-CF009806EQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P60019
Storage Buffer Tris-based buffer,50% glycerol
Species Pan troglodytes (Chimpanzee)
Sequence MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTS YSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKW TLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWM LALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIK IGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFK PGYSLHDTSVAVKIQSSSKST
Source in vitro E.coli expression system
Gene Names GPR34
Protein Names Recommended name: Probable G-protein coupled receptor 34
Expression Region 1-381
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: ptr:473572

UniGene: Ptr.6306

Related Products

GPR34 Proteins

GPR34 Proteins for Pan troglodytes (Chimpanzee)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.