Recombinant Pan troglodytes fMet-Leu-Phe receptor(FPR1)

Code CSB-CF008854EQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P79241
Storage Buffer Tris-based buffer,50% glycerol
Species Pan troglodytes (Chimpanzee)
Sequence NSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTIS YLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFIFTIVDINLFGSVFLIALIALDR CVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPW TNDPKERINVAIAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKFSRPLRVL SFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVF MGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVALQA
Source in vitro E.coli expression system
Gene Names FPR1
Protein Names Recommended name: fMet-Leu-Phe receptor Short name= fMLP receptor Alternative name(s): N-formyl peptide receptor Short name= FPR N-formylpeptide chemoattractant receptor
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 9598.ENSPTRP00000019567

Pathway Rap1 signaling pathway

Related Products

FPR1 Proteins

FPR1 Proteins for Pan troglodytes (Chimpanzee)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.