Recombinant Pasteurella multocida Electron transport complex protein RnfE(rnfE)

Code CSB-CF887395ESG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9CNP5
Storage Buffer Tris-based buffer,50% glycerol
Species Pasteurella multocida (strain Pm70)
Sequence MDQQSTLANTSTPSVWKTLFWQGVWKNNSTLVQLLGLCPLLAVSNSVTNALGLGIATLFV LICSNTVVSLFRKQIPHEIRIPIYVMIIATTVTVVQLLMNAYTYSLYQSLGIFIPLIVTN CIVIGRAEAFASKNPLSHAMFDGFAMGLGMCLSLVFLGAIREILGNGTLFDGIEHLLGDW AKGLRIELFHLDSHFLLAILPPGAFIGLGLILAIKNVIDQRNKA
Source in vitro E.coli expression system
Gene Names PM0382
Protein Names Recommended name: Electron transport complex protein RnfE
Expression Region 1-224
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of a membrane complex involved in electron transport.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families NqrDE/RnfAE family
Database Links

KEGG: pmu:PM0382

STRING: 272843.PM0382

Related Products

PM0382 Proteins

PM0382 Proteins for Pasteurella multocida (strain Pm70)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.