Recombinant Pig Glycophorin-A(GYPA)

Code CSB-CF010074PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P02725
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Sequence TETPVTGEQGSATPGNVSNATVTAGKPSATSPGVMTIKNTTAVVQKETGVPESYHQDFSHAEITGIIFAVMAGLLLIIFLIAYLIRRMIKKPLPVPKPQDSPDIGTENTADPSELQDTEDPPLTSVEIETPAS
Source in vitro E.coli expression system
Gene Names GYPA
Protein Names Recommended name: Glycophorin-A Alternative name(s): CD_antigen= CD235a
Expression Region 1-133
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Glycophorin A is the major intrinsic membrane sialoglycoprotein of the erythrocyte. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Glycophorin-A family
Pathway Hematopoietic cell lineage

Related Products

GYPA Proteins

GYPA Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.