Recombinant Pig Melanocortin receptor 4 (MC4R)

Code CSB-CF013561PI
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
MC4R; Melanocortin receptor 4; MC4-R
Species
Sus scrofa (Pig)
Expression Region
1-332
Target Protein Sequence
MNSTHHHGMHTSLHFWNRSTYGLHSNASEPLGKGYSEGGCYEQLFVSPEVFVTLGVISLL ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAVCTVS GVLFIIYSDSSAVIICLITVFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGTIRQGAN MKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPL IYALRSQELRKTFKEIICCYPLGGLCDLSSRY
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor specific to the heptapeptide core common to adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH. Plays a central role in energy homeostasis and somatic growth. This receptor is mediated by G proteins that stimulate adenylate cyclase (cAMP).
Gene References into Functions
  1. These results indicate that genetic selection against boar taint is possible using MC4R as a marker. PMID: 26020871
  2. These results suggest that LEPR, MC4R, PIK3C3 and VRTN are useful markers for accurately predicting breeding values in Duroc pigs. PMID: 24128088
  3. Transcriptional profiling was used to identify genes and pathways that responded to intracerebroventricular injection of MC4R agonist [Nle(4), d-Phe(7)]-alpha-melanocyte stimulating hormone in pigs homozygous for the missense mutation in the MC4R. PMID: 20215418
  4. study did not find any significant associations for polymorphisms in insulin-like grwoth factor 2, GTP Binding Protein alpha Subunits, Gs and melanocortin receptor 4 genes with reproductive traits of Polish Landrace and Large White pigs PMID: 23199214
  5. Linkage disequilibrium analysis among MC4R, LEP and H-FABP revealed that these genes were independent. PMID: 22290286
  6. The c.1426G>A polymorphism affects daily gain, feed conversion ratio and ham weight in both breeds, lean cuts in the Italian Duroc and backfat thickness in the Italian Large White. PMID: 22197097
  7. MC4R allelic variants had no effects on meat quality traits. PMID: 21196086
  8. The effects of missense mutations of MC4R on carcass composition, growth traits and meat quality in 1191 gilts of five swine breeds are reported. PMID: 20374902
  9. No effect of the MC4R trait nucleotides could be seen on muscle growth. PMID: 19674865
  10. Results of associated analysis show that the polymorphism of MC4R gene was associated traits of back fat thickness (BF). PMID: 16520310
  11. A polymorphism within the MC4R gene is associated with feed intake and increased growth. PMID: 16734684
  12. A polymorphism within the MC4R gene is associated with the fat/meat ratio. PMID: 16879346
  13. Characterization of polymorphisms in the MC4R gene in relation to growth and fat deposition. PMID: 16879362
  14. pMC4R mutants D298N and R236H do not have any overt functional defects. PMID: 18262384
  15. sequenced MC4R genes in 72 pigs belonging to lean (Large White and Duroc), fat (Meishan and Casertana) breeds and also Wild Boar PMID: 18363978

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1