Recombinant Pig Platelet-activating factor receptor(PTAFR)

Code CSB-CF018946PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9XSD4
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Sequence MEPNDSWRVDSEFRYTLFPIFYSIIFVLGVIANSYVLWVFARVYPSKKLNEIKIFMLNLT MADLLFLVTLPLWIIYYYHEGNWILPKFLCNLAGCFFFINTYCSVSFLAVITYNRFQAVT RPIKTAQATTRKRGISLSLIIWVAMVAAASYFFVLDSTNIELSKTGAGNLTRCFEHYEKG SMPVLIIHIFLVFSFFLVFLVILFCNLVIIRTLLTQSVQMQRNAEVKRRALWMVCTVLAV FIICFVPHHIVQLPWTLAELGFQSGNFHQAINDAHQITLCLLSTNCVLDPIIYCFLTKKF RKHLSEKFYSLRGSRKCSRVTTETGTEVVVPLSQVPVNSLKK
Source in vitro E.coli expression system
Gene Names PTAFR
Protein Names Recommended name: Platelet-activating factor receptor Short name= PAF-R Short name= PAFr
Expression Region 1-342
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system. May have a role in peri-implantation development during pregnancy (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Differentially expressed in the lung, heart, liver, skeletal muscle, kidney, spleen, small intestine, endometrium and white blood cells. Expression levels are higher in the endometrium of pregnant compared to non-pregnant individuals. Endometrial and embr
Pathway Calcium signaling pathway

Related Products

PTAFR Proteins

PTAFR Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.