Recombinant Pig Vasoactive intestinal polypeptide receptor 1(VIPR1)

Code CSB-CF637928PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q28992
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Sus scrofa (Pig)
Sequence GLQQEECDYLQMIKVQHKQCLEEAQLENETSGCSKMWDNLTCWPATPRGQVVVLACPLIF KLFSPTQGLNVSRNCTDEGWTPLEPGPYPIACGMDDKASGLDEQQTVFYNSVKTGYTIGY SLSLAALLVATAILSLFRKLHCTRNYIHMHLFISFILRATAVFIKDLALFDSEESDHCSK GSVGCKAAVVLFQYCVMANFFWLLVEGLYLHTLLAVSFFSERKYFWGYIFVGWGVPSTFI MVWTVVRIHFEDYGCWDTIHSSLWWIIKAPILASILVNFILFIRIIGILVQKLRPPDVGK SDNSPYSRLAKSTLLLIPLFGVHYIMFAFFPDNFKAEVKMVFELIVGSFQGCVVAILYCF LNGEVQAELRRKWRRWHQQGVLGWDSKYQHPSGGSNGDTCSTQVSMLTRVSPSARRSSSF QAEVSLV
Source in vitro E.coli expression system
Gene Names VIPR1
Protein Names Recommended name: Vasoactive intestinal polypeptide receptor 1 Short name= VIP-R-1 Alternative name(s): Pituitary adenylate cyclase-activating polypeptide type II receptor Short name= PACAP type II receptor Short name= PACAP-R
Expression Region 32-458
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Database Links

KEGG: ssc:100155402

STRING: 9823.ENSSSCP00000012026

UniGene: Ssc.136

Related Products

VIPR1 Proteins

VIPR1 Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.