Recombinant Polypeptide N-acetylgalactosaminyltransferase 3(gly-3)

Code CSB-CF009210CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P34678
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MLSVGGGRSAVCRAVIATSIVWLLIDVVILFYYLDPSTSQQQPFPEDNRILNRARRIEPLPPAAQHDSDPDAHPIQPEKQEKQVYPVDKETANQLRKLMETQAFGPGYHGQGGTGVTVPEDKKTIKEKRFLENQFNVVASEMISVNRTLPDYRSDACRTSGNNLKTAGMPKTSIIIVFHNEAWTTLLRTLHSVINRSPRHLLEEIILVDDKSDRDYLVKPLDSYIKMFPIPIHLVHLENRSGLIRARLTGSEMAKGKILLFLDAHVEVTDGWLEPLVSRVAEDRKRVVAPIIDVISDDTFEYVTASETTWGGFNWHLNFRWYAVPKRELNRRGSDRSMPIQTPTIAGGLFAIDKQFFYDIGSYDEGMQVWGGENLEISFRVWMCGGSLEIHPCSRVGHVFRKQTPYTFPGGTAKVIHHNAARTAEVWMDEYKAFFYKMVPAARNVEAGDVSERKKLRETLQCKSFKWYLENIYPEAPLPADFRSLGAIVNRFTEKCVDTNGKKDGQAPGIQACHGAGGNQAWSLTGKGEIRSDDLCLSSGHVYQIGSELKLERCSVSKINVKHVFVFDDQAGTLLHKKTGKCVTGADQRVTLDECGLGRKDQMWQLEGYQSP
Source in vitro E.coli expression system
Gene Names gly-3
Protein Names Recommended name: Polypeptide N-acetylgalactosaminyltransferase 3 EC= 2.4.1.41 Alternative name(s): GalNAc-T1 Protein-UDP acetylgalactosaminyltransferase 3 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3 Short name= pp-GaNTase 3
Expression Region 1-612
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 2 family, GalNAc-T subfamily
Database Links

KEGG: cel:CELE_ZK688.8

STRING: 6239.ZK688.8.1

UniGene: Cel.17588

Related Products

gly-3 Antibodies

gly-3 Antibodies for Caenorhabditis elegans

gly-3 Proteins

gly-3 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.