Recombinant Polypeptide N-acetylgalactosaminyltransferase 3(gly-3)

Code CSB-CF009210CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P34678
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MLSVGGGRSAVCRAVIATSIVWLLIDVVILFYYLDPSTSQQQPFPEDNRILNRARRIEPLPPAAQHDSDPDAHPIQPEKQEKQVYPVDKETANQLRKLMETQAFGPGYHGQGGTGVTVPEDKKTIKEKRFLENQFNVVASEMISVNRTLPDYRSDACRTSGNNLKTAGMPKTSIIIVFHNEAWTTLLRTLHSVINRSPRHLLEEIILVDDKSDRDYLVKPLDSYIKMFPIPIHLVHLENRSGLIRARLTGSEMAKGKILLFLDAHVEVTDGWLEPLVSRVAEDRKRVVAPIIDVISDDTFEYVTASETTWGGFNWHLNFRWYAVPKRELNRRGSDRSMPIQTPTIAGGLFAIDKQFFYDIGSYDEGMQVWGGENLEISFRVWMCGGSLEIHPCSRVGHVFRKQTPYTFPGGTAKVIHHNAARTAEVWMDEYKAFFYKMVPAARNVEAGDVSERKKLRETLQCKSFKWYLENIYPEAPLPADFRSLGAIVNRFTEKCVDTNGKKDGQAPGIQACHGAGGNQAWSLTGKGEIRSDDLCLSSGHVYQIGSELKLERCSVSKINVKHVFVFDDQAGTLLHKKTGKCVTGADQRVTLDECGLGRKDQMWQLEGYQSP
Source in vitro E.coli expression system
Gene Names gly-3
Protein Names Recommended name: Polypeptide N-acetylgalactosaminyltransferase 3 EC= 2.4.1.41 Alternative name(s): GalNAc-T1 Protein-UDP acetylgalactosaminyltransferase 3 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3 Short name= pp-GaNTase 3
Expression Region 1-612
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 2 family, GalNAc-T subfamily
Database Links

KEGG: cel:CELE_ZK688.8

STRING: 6239.ZK688.8.1

UniGene: Cel.17588

Related Products

gly-3 Antibodies

gly-3 Antibodies for Caenorhabditis elegans

gly-3 Proteins

gly-3 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.