Recombinant Pongo abelii Peroxisomal membrane protein 11B(PEX11B)

Code CSB-CF732819PYX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5RFI0
Storage Buffer Tris-based buffer,50% glycerol
Species Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Sequence MDAWVRFSAQSQARERLCRAAQYACSLLGHVLQRHGASPELQKQIRQLESHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG GHLPQLALKLRLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGL VSSILSILTLIYPWLRLKP
Source in vitro E.coli expression system
Gene Names PEX11B
Protein Names Recommended name: Peroxisomal membrane protein 11B Alternative name(s): Peroxin-11B Peroxisomal biogenesis factor 11B Protein PEX11 homolog beta Short name= PEX11-beta
Expression Region 1-259
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in peroxisomal proliferation. May regulate peroxisome division by recruiting the dynamin-related GTPase DNM1L to the peroxisomal membrane. Promotes membrane protrusion and elongation on the peroxisomal surface.
Subcellular Location Peroxisome membrane, Single-pass membrane protein
Protein Families Peroxin-11 family
Database Links

KEGG: pon:100174204

STRING: 9601.ENSPPYP00000001084

Related Products

PEX11B Proteins

PEX11B Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.