Recombinant Pongo abelii Vacuole membrane protein 1(VMP1)

Code CSB-CF728993PYX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5R9K4
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Sequence MAENGKNCDQRRVAMNKEQHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLE ILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGAHQQYVQRIEKQFLLYAYWIGLG ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEGGTEGTISL WSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDF ASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG ENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
Source in vitro E.coli expression system
Gene Names VMP1
Protein Names Recommended name: Vacuole membrane protein 1 Alternative name(s): Transmembrane protein 49
Expression Region 1-406
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions. Plays a role in the initial stages of the autophagic process through its interaction with BECN1 (By similarity).
Subcellular Location Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Vacuole membrane, Multi-pass membrane protein, Endoplasmic reticulum
Protein Families VMP1 family
Database Links

KEGG: pon:100172847

STRING: 9601.ENSPPYP00000009889

Pathway Autophagy

Related Products

VMP1 Proteins

VMP1 Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.