Recombinant Pongo pygmaeus Taste receptor type 2 member 3(TAS2R3)

Code CSB-CF717554EXP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q645U2
Storage Buffer Tris-based buffer,50% glycerol
Species Pongo pygmaeus (Bornean orangutan)
Sequence MGLTEGLFLILSGTQFALGILVNCFIGLVNGSSWFKTKRMSLSDFIITTLAFLRIILLCI ILTDSFLIEFSPNAHDSGVIMQIIDVSWTFTNHLSIWLATCLGVLYCLKIASFSHPTFLW LKWRVSRVMVWMLLGVLLLSCGSTASLINEFKLYSVFRGIEATXNVTEHFRKKRSEYYLI HVLGTLWYLPPLIVSLAAYFLLIFSLGRHTRQMLQNGTSSRDPSTEAHKRAIRIILSSFF LFLLYFLAFLIASFGNFLPKTKMAKMIGEVMTMFYPAGHSFILILGNSKLKQTFVEMLRC ESGHLKPGSKGPIFS
Source in vitro E.coli expression system
Gene Names TAS2R3
Protein Names Recommended name: Taste receptor type 2 member 3 Short name= T2R3
Expression Region 1-315
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5 (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor T2R family

Related Products

TAS2R3 Proteins

TAS2R3 Proteins for Pongo pygmaeus (Bornean orangutan)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.