Recombinant Human papillomavirus type 16 Probable protein E5(E5)

Code CSB-CF361986HML
Product Type Transmembrane Protein
Size US$3219
Uniprot No. P06927
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Human papillomavirus type 16
Sequence MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCF IVYIIFVYIPLFLIHTHARFLIT
Source in vitro E.coli expression system
Gene Names E5
Protein Names Recommended name: Probable protein E5
Expression Region 1-83
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts to keep host cells in a proliferation-competent state upon differentiation. Enhances host epidermal growth factor receptor (EGFR) activation after stimulation by EGF by inhibiting EGFR internalization. Induces a redistribution of host caveolin-1 and glycosphingolipid (ganglioside GM1) components of lipid rafts to the plasma membrane. Since GM1s inhibit cytotoxic T-lymphocytes, block immune synapse formation, and enhance proliferative signaling by the EGFR, E5 may enhance immune evasion and cell proliferation via a common mechanism. E5 also alters endosomal pH by interacting with the vacuolar H+-ATPase, which is a proton pump responsible for acidifying cellular organelles. Additionally, E5 prevents transport of the major histocompatibility class I to the cell surface and retains the complex in the Golgi apparatus.
Subcellular Location Host membrane, Multi-pass membrane protein, Host endoplasmic reticulum membrane, Host Golgi apparatus
Protein Families Papillomaviridae E5 protein family
Database Links

KEGG: vg:1489077

Related Products

E5 Proteins

E5 Proteins for Human papillomavirus type 16

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.