Recombinant Human papillomavirus type 16 Probable protein E5 (E5)

Code CSB-CF361986HML
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
E5
Uniprot No.
Alternative Names
E5; Probable protein E5
Species
Human papillomavirus type 16
Expression Region
1-83
Target Protein Sequence
MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCF IVYIIFVYIPLFLIHTHARFLIT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts to keep host cells in a proliferation-competent state upon differentiation. Enhances host epidermal growth factor receptor (EGFR) activation after stimulation by EGF by inhibiting EGFR internalization. Induces a redistribution of host caveolin-1 and glycosphingolipid (ganglioside GM1) components of lipid rafts to the plasma membrane. Since GM1s inhibit cytotoxic T-lymphocytes, block immune synapse formation, and enhance proliferative signaling by the EGFR, E5 may enhance immune evasion and cell proliferation via a common mechanism. E5 also alters endosomal pH by interacting with the vacuolar H+-ATPase, which is a proton pump responsible for acidifying cellular organelles. Additionally, E5 prevents transport of the major histocompatibility class I to the cell surface and retains the complex in the Golgi apparatus.
Gene References into Functions
  1. HPV16 E5 is produced from an HPV16 early mRNA spliced from SD226 to SA3358. PMID: 29155138
  2. findings show Human papillomavirus type 16 oncogene E5 is primarily responsible for Met upregulation; E5-induced Met contributes motility of HPV-containing cells; these studies show a new role for E5 in epithelial-stromal interactions, with implications for cancer development PMID: 29609071
  3. A transcriptional crosstalk among 16E5 and KGFR might be the crucial molecular driver of epithelial deregulation during early steps of HPV infection and transformation. PMID: 25826082
  4. HPV16 early gene E5 specifically down-regulated miRNA196a in the cervical cancer cell lines. PMID: 25563170
  5. Results show that HPV16 E5 down-modulates FGFR2b and induces FGFR2c expression in human keratinocytes and cervical epithelial cells through down-modulation of ESRPs. PMID: 25450802
  6. Graphene nanoribbons elicit cell specific uptake and delivery via activation of epidermal growth factor receptor enhanced by human papillomavirus E5 protein. PMID: 24980059
  7. Data indicate HPV16 E5 as a possible target on the therapeutic strategies about cervical cancer. PMID: 24142729
  8. Human papillomavirus E5 oncoproteins bind the A4 in endoplasmic reticulum to regulate proliferative ability upon differentiation. PMID: 24606699
  9. This review attempts to discuss the positive role of HPV16 E5 in the form of therapeutic target for cervical cancer. PMID: 22262402
  10. No firm conclusion could be drawn about the correlation between the E5 expression and the disease progression in patients with squamous intra-epithelial lesions of the cervix. PMID: 21767984
  11. Both the annexin A2 and p11 subunits of calpactin I coimmunoprecipitate with human papillomavirus type 16 E5 in COS cells and in human epithelial cell lines, and an intact E5 C terminus is required for binding. PMID: 21849434
  12. HPV infection and subsequent transformation take place through complex regulatory patterns of gene expression in the host cells, part of which are regulated by the E5 protein PMID: 21747943
  13. The authors show that the human papillomavirus type 16 E5 protein expression per se stimulates IFN-beta expression this stimulation is specifically mediated by the induction of interferon regulatory factor 1. PMID: 21389130
  14. 16E5 alters EGF endocytic trafficking via a pH-independent inhibition of vesicle fusion. PMID: 20686024
  15. CD1d is downregulated by the HPV16 E5 and HPV6 E5 protein. PMID: 20810727
  16. these data indicate that E5 represses the cellular endoplasmic reticulum stress response and suggest a potential role for E5 during productive HPV infection. PMID: 20688044
  17. The authors show that the human papillomavirus 16 E5 protein-induced reduction of HLA-A2 has a functional impact by reducing recognition of E5 expressing cells by human papillomavirus specific CD8+ T cells. PMID: 20813390
  18. HPV16 E5 produces polyploid cells and enlarged nucleic by endoreplication. These findings provide insight into how HPV16 E5 can contribute to cell transformation. PMID: 20605566
  19. 4075T is highly conserved in E5 of human papillomavirus type 16 isolated from Asia. PMID: 20718354
  20. HPV-16 E5 impaired the viability of trophoblastic and cervical cell lines. E5 & E6/E7 increase chemotaxic & invasive properties of trophoblastic cells. HPV-16 E5 participated, with E6 & E7, in these changes by impairing E-cadherin expression. PMID: 19917629
  21. HPV 16 E5 protein contributes to cervical carcinogenesis by inhibiting apoptosis of transformed cervical epithelial cells. PMID: 20015862
  22. E5 and the EGF-receptor cooperate to enhance cell cycle entry and progression through regulating p27(Kip1) expression at protein level. PMID: 20144468
  23. topology findings are compatible with a model of E5 being a 3-pass transmembrane protein and with studies demonstrating its C terminus interacting with cytoplasmic proteins PMID: 19955310
  24. The first hydrophobic domain of E5 is required for invasion of cell matrix. PMID: 19812262
  25. functions of E5 protein are not mediated by morphological alterations in the actin cytoskeleton, microtubulus network or adhesion to the extrcellular matrix; colocalization E5 with the Bcl-2 antiapoptotic protein on intracellular membranes was established PMID: 15593417
  26. -16 E5 protein can form a complex with ErbB4 via binding to the extracellular and transmembrane domains of ErbB4 (JM-b/CYT-1). PMID: 16819515
  27. E5 can interfere with antigen presentation by most, if not all, classical HLA I haplotypes. PMID: 16823848
  28. Increases cell membrane expression of caveolin-1, induces a 23- to 40-fold increase in lipid raft component ganglioside GM1 at the cell membrane of E5-expressing uterine cervical cells, and mediates a dramatic increase in caveolin-1/GM1 association. PMID: 17704805
  29. HPV-16 E5 protein binds to karyopherin beta3. PMID: 18455505
  30. Results identify B-cell-associated protein 31 as a novel binding partner of the high-risk human papillomavirus 16 E5 proteins and provide insight into how the E5 proteins may modulate the life cycle in differentiating cells. PMID: 18684816
  31. Using biochemical and cell biological assays to better understand HPV16 E5, the authors find that HPV16 E5 localizes to the plasma membrane with an intracellular amino terminus and an extracellular carboxyl-terminus. PMID: 19712955

Show More

Hide All

Subcellular Location
Host membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane. Host Golgi apparatus.
Protein Families
Papillomaviridae E5 protein family
Database Links

KEGG: vg:1489077

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1