Recombinant Protein jagunal homolog(K05C4.2)

Code CSB-CF894562CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9XUU9
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MSSRGVRAAGTDGTDFQNRQRVAQHYQESAQYKSILKWFFVPHFLILVFMWLKVGSELLR TNFGWKNAFFDRLDMPSAYPWEYVWCFSFIPIVLAIYSFQRNKLKILHYAYYAEFVVGIF PCMIGLGGQLPELMEYAQDMEGSNTPTFKGIFPMVIIWYIFFAVALQIHGFSMYFMHHLA AAWAPVKRD
Source in vitro E.coli expression system
Gene Names K05C4.2
Protein Names Recommended name: Protein jagunal homolog
Expression Region 1-189
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Jagunal family
Database Links

KEGG: cel:CELE_K05C4.2

STRING: 6239.K05C4.2.2

UniGene: Cel.38967

Related Products

K05C4.2 Antibodies

K05C4.2 Antibodies for Caenorhabditis elegans

K05C4.2 Proteins

K05C4.2 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.