Recombinant Pseudomonas aeruginosa Type II secretion system protein L(xcpY)

Code CSB-CF335090EZX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P25060
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Sequence MSGVSALFLPPASTAGADGELAVWWVQDGECRRAPFAQALAEIRAPWRLYLPVEAVTACA VNLPTQKARWLRQSLPFAVEEQLADDVEQMHLALGPALADGRHRVFAVQRTWLAAWLALA EGAGKAPASLHVDADCLPGEGSCLFWLEERWLLGGSGAVRLACGSEDWPVLRDSCPPPQR AFAAQEVAPLEGVEVQALAGNPHVWLSEQPLGTDLAQAEFAARQQSSQWRRWRPLLGLVG LWLVLQWGFTLVQAWQLQREGDRYAAQSAELYRQLFPEDRKLINLRAQFDQHLADSASSG GEGQLLGLLGQAATVIGGEPTVSVEQLDFSAARGDVALQVRAPGFDVLERLRSRLSESGL AVQLGSASRDGSTVSARLVIGG
Source in vitro E.coli expression system
Gene Names xcpY
Protein Names Recommended name: Type II secretion system protein L Short name= T2SS protein L Alternative name(s): General secretion pathway protein L
Expression Region 1-382
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in a type II secretion system (T2SS, formerly general secretion pathway, GSP) for the export of proteins.
Subcellular Location Cell inner membrane
Protein Families GSP L family
Database Links

KEGG: pae:PA3096

STRING: 208964.PA3096

Related Products

xcpY Proteins

xcpY Proteins for Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.