Recombinant Pseudomonas aeruginosa Type II secretion system protein L(xcpY)

Code CSB-CF335090EZX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P25060
Storage Buffer Tris-based buffer,50% glycerol
Species Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Sequence MSGVSALFLPPASTAGADGELAVWWVQDGECRRAPFAQALAEIRAPWRLYLPVEAVTACA VNLPTQKARWLRQSLPFAVEEQLADDVEQMHLALGPALADGRHRVFAVQRTWLAAWLALA EGAGKAPASLHVDADCLPGEGSCLFWLEERWLLGGSGAVRLACGSEDWPVLRDSCPPPQR AFAAQEVAPLEGVEVQALAGNPHVWLSEQPLGTDLAQAEFAARQQSSQWRRWRPLLGLVG LWLVLQWGFTLVQAWQLQREGDRYAAQSAELYRQLFPEDRKLINLRAQFDQHLADSASSG GEGQLLGLLGQAATVIGGEPTVSVEQLDFSAARGDVALQVRAPGFDVLERLRSRLSESGL AVQLGSASRDGSTVSARLVIGG
Source in vitro E.coli expression system
Gene Names xcpY
Protein Names Recommended name: Type II secretion system protein L Short name= T2SS protein L Alternative name(s): General secretion pathway protein L
Expression Region 1-382
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in a type II secretion system (T2SS, formerly general secretion pathway, GSP) for the export of proteins.
Subcellular Location Cell inner membrane
Protein Families GSP L family
Database Links

KEGG: pae:PA3096

STRING: 208964.PA3096

Related Products

xcpY Proteins

xcpY Proteins for Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.